NOV/CCN3 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

NOV/CCN3 protein, functioning as an immediate-early participant, plays a pivotal role in a diverse array of cellular processes encompassing proliferation, adhesion, migration, differentiation, and survival. Operating through binding interactions with integrins or membrane receptors such as NOTCH1, NOV/CCN3 emerges as an essential regulator of hematopoietic stem and progenitor cell function. It inhibits myogenic differentiation by activating the Notch-signaling pathway and curtails vascular smooth muscle cells proliferation independently of TGFB1 signaling, influencing the expression of cell-cycle regulators like CDKN2B or CDKN1A. As a ligand for integrins ITGAV:ITGB3 and ITGA5:ITGB1, NOV/CCN3 directly stimulates pro-angiogenic activities, induces angiogenesis, and supports endothelial cell adhesion, migration, and survival. Additionally, it plays roles in cutaneous wound healing, skin fibroblast adhesion, and chemotaxis through interactions with various integrin pairs. Moreover, NOV/CCN3 contributes to bone regeneration, negatively regulating the articular chondrocytic phenotype while repressing endochondral ossification. It also affects pancreatic beta-cell function, acting as a negative regulator by inhibiting beta-cell proliferation and insulin secretion. Functioning as a negative regulator of endothelial pro-inflammatory activation, it reduces monocyte adhesion and exerts anti-inflammatory effects by inhibiting the NF-kappaB signaling pathway. NOV/CCN3 further contributes to the control of inflammatory processes in atherosclerosis and attenuates inflammatory pain through the regulation of IL1B- and TNF-induced MMP9, MMP2, and CCL2 expression, inhibiting MMP9 expression through engagement with ITGB1. It engages in diverse protein interactions, including FBLN1, NOTCH1, GJA1/CX43, ITGA5:ITGB1, ITGAV:ITGB3, ITGAV:ITGB5, and ZDHHC22, potentially leading to CCN3 palmitoylation. The breadth of these interactions underscores the intricate and multifaceted role of NOV/CCN3 in cellular processes and regulatory pathways.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCN3 (S26-I354)
      Accession # Q64299
    • 6*His
    • C-term
  • Protein Length

    Full Length of CCN family member 3 Chain

  • Synonyms

    CCN3; Protein NOV Homolog; Prev. NOV; IBP-9; IGFBP9; Nephroblastoma-Overexpressed Gene Protein Homolog; Nephro Blastoma-Overexpressed Gene Protein Homolog; Nephroblastoma Overexpressed Gene; Insulin-Like Growth Factor-Binding Protein 9; NOVh; Nephroblasto

  • AA Sequence

    SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

  • Predicted Molecular Mass

    37.1 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00