NOV/CCN3 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NOV/CCN3 protein is an early player that coordinates diverse cellular processes such as proliferation, adhesion, migration, differentiation, and survival.By interacting with membrane receptors such as integrins or NOTCH1, it regulates hematopoietic stem cells and inhibits myogenic differentiation while affecting the expression of cell cycle regulators.NOV/CCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NOV/CCN3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
NOV/CCN3 protein, functioning as an immediate-early participant, plays a pivotal role in a diverse array of cellular processes encompassing proliferation, adhesion, migration, differentiation, and survival. Operating through binding interactions with integrins or membrane receptors such as NOTCH1, NOV/CCN3 emerges as an essential regulator of hematopoietic stem and progenitor cell function. It inhibits myogenic differentiation by activating the Notch-signaling pathway and curtails vascular smooth muscle cells proliferation independently of TGFB1 signaling, influencing the expression of cell-cycle regulators like CDKN2B or CDKN1A. As a ligand for integrins ITGAV:ITGB3 and ITGA5:ITGB1, NOV/CCN3 directly stimulates pro-angiogenic activities, induces angiogenesis, and supports endothelial cell adhesion, migration, and survival. Additionally, it plays roles in cutaneous wound healing, skin fibroblast adhesion, and chemotaxis through interactions with various integrin pairs. Moreover, NOV/CCN3 contributes to bone regeneration, negatively regulating the articular chondrocytic phenotype while repressing endochondral ossification. It also affects pancreatic beta-cell function, acting as a negative regulator by inhibiting beta-cell proliferation and insulin secretion. Functioning as a negative regulator of endothelial pro-inflammatory activation, it reduces monocyte adhesion and exerts anti-inflammatory effects by inhibiting the NF-kappaB signaling pathway. NOV/CCN3 further contributes to the control of inflammatory processes in atherosclerosis and attenuates inflammatory pain through the regulation of IL1B- and TNF-induced MMP9, MMP2, and CCL2 expression, inhibiting MMP9 expression through engagement with ITGB1. It engages in diverse protein interactions, including FBLN1, NOTCH1, GJA1/CX43, ITGA5:ITGB1, ITGAV:ITGB3, ITGAV:ITGB5, and ZDHHC22, potentially leading to CCN3 palmitoylation. The breadth of these interactions underscores the intricate and multifaceted role of NOV/CCN3 in cellular processes and regulatory pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q64299 (S26-I354)
-
Molecular Construction
-
N-term
-
CCN3 (S26-I354)
Accession # Q64299 -
6*His
-
C-term
-
-
Protein Length
Full Length of CCN family member 3 Chain
-
Synonyms
CCN3; Protein NOV Homolog; Prev. NOV; IBP-9; IGFBP9; Nephroblastoma-Overexpressed Gene Protein Homolog; Nephro Blastoma-Overexpressed Gene Protein Homolog; Nephroblastoma Overexpressed Gene; Insulin-Like Growth Factor-Binding Protein 9; NOVh; Nephroblasto
-
AA Sequence
SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI
-
Predicted Molecular Mass
37.1 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)