1. Recombinant Proteins
  2. Others
  3. CCND2 Protein, Human (His)

CCND2 Protein, Human (His)

Cat. No.: HY-P7773
Handling Instructions

CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

Background

CCND2 (Cyclin D2), is a member of the Cyclin family, along with Cyclin D1, Cyclin D3, and Cyclin E, which act as cell cycle regulatory proteins. CCND2 promotes cell cycle progression by binding and activating cyclin-dependent kinase 4 (cdk4)/cdk6. The activated CCND2-cdk4/cdk6 complex over-phosphorylates the tumor suppressor protein pRB, promotes the release, and activation of the transcription factor E2F, and targets the production of several proteins required to regulate cell cycle progression. CCND2 is abnormally expressed in a variety of malignant tumors, including colorectal, prostate, and bladder cancers. The function of CCND2 is primarily related to the regulation of cell cycle[1].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P30279 (M1-L289)

Gene ID

894  [NCBI]

Molecular Construction
N-term
6*His
CCND2 (M1-L289)
Accession # P30279
C-term
Synonyms
rHuCCND2, His; G1/S-specific cyclin-D2; CCND2
AA Sequence

HHHHHHMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Molecular Weight

Approximately 35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

CCND2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCND2 Protein, Human (His)
Cat. No.:
HY-P7773
Quantity:
MCE Japan Authorized Agent: