CCND2 Protein, Human (His)
CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.
Background
CCND2 (Cyclin D2), is a member of the Cyclin family, along with Cyclin D1, Cyclin D3, and Cyclin E, which act as cell cycle regulatory proteins. CCND2 promotes cell cycle progression by binding and activating cyclin-dependent kinase 4 (cdk4)/cdk6. The activated CCND2-cdk4/cdk6 complex over-phosphorylates the tumor suppressor protein pRB, promotes the release, and activation of the transcription factor E2F, and targets the production of several proteins required to regulate cell cycle progression. CCND2 is abnormally expressed in a variety of malignant tumors, including colorectal, prostate, and bladder cancers. The function of CCND2 is primarily related to the regulation of cell cycle[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P30279 (M1-L289)
-
Molecular Construction
-
N-term
-
6*His
-
CCND2 (M1-L289)
Accession # P30279 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CCND2; G1/S-Specific Cyclin D2; Cyclin D2; KIAK0002; G1/S-Specific Cyclin-D2; MPPH3
-
AA Sequence
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
-
Predicted Molecular Mass
35.4 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)