CCND2 Protein, Human (His)

CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

Background

CCND2 (Cyclin D2), is a member of the Cyclin family, along with Cyclin D1, Cyclin D3, and Cyclin E, which act as cell cycle regulatory proteins. CCND2 promotes cell cycle progression by binding and activating cyclin-dependent kinase 4 (cdk4)/cdk6. The activated CCND2-cdk4/cdk6 complex over-phosphorylates the tumor suppressor protein pRB, promotes the release, and activation of the transcription factor E2F, and targets the production of several proteins required to regulate cell cycle progression. CCND2 is abnormally expressed in a variety of malignant tumors, including colorectal, prostate, and bladder cancers. The function of CCND2 is primarily related to the regulation of cell cycle[1].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CCND2 (M1-L289)
      Accession # P30279
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CCND2; G1/S-Specific Cyclin D2; Cyclin D2; KIAK0002; G1/S-Specific Cyclin-D2; MPPH3

  • AA Sequence

    MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

  • Predicted Molecular Mass

    35.4 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00