1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors B Cell CD Proteins NK Cell CD Proteins Stem Cell CD Proteins Cytokine Receptors
  4. IL-7 Receptor
  5. CD127/IL-7RA
  6. CD127/IL-7RA Protein, Cynomolgus (HEK293, His)

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
> 250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235)[1][2].

Background

IL-7R α-chain (IL-7RA; also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL-7 and other alpha helical cytokines. IL-7RA is almost exclusively expressed by cells of the lymphoid lineage that plays an important role in lymphocyte differentiation, proliferation, and survival.  IL-7RA gene is localised on chromosome 5p13.3[1][2].
The amino acid sequence of human IL-7RA protein has low homology between mouse and rat IL-7RA protein. While, human IL-7RA shares 97% aa sequence identity with monkey IL-7RA protein.
IL-7 is classified as a type 1 short-chain cytokine of the hematopoietin family. Physiologic roles of IL-7 involve modulation of T- and B-cell development and T-cell homeostasis. To perform all pleiotropic functions of IL-7 in immune system, IL-7 binds through a transmembrane receptor, which is formed by heterodimerizing of the common cytokine gamma chain (γc; also known as CD132) and IL-7RA. IL-7RA consists of an extracellular domain, transmembrane region and cytoplasmic tail, that recruits kinases for signal transduction. IL-7RA is organized in eight exons, spanning 18 kb of genomic DNA. The protein has a folding typical for the insertion of a helical cytokine, and it is composed of an intracellular domain (195 aa), a transmembrane domain (25 aa), and an extracellular region (220 aa). The latter shares homology with other members of the type I family of cytokine receptors. Close to the transmembrane domain, the extracellular region of IL-7Ra contains a Trp-Ser-X-Trp-Ser (WSXWS) motif involved in proper folding of the protein. Finally, the extracellular region also contains two fibronectin type III-like domains. Soluble or membrane-bound isoforms of IL-7RA are produced according to the alternative splicing of exon 6 in IL7RA gene. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP)[1][2][3].
IL-7RA associates with γc to form the functional high affinity IL-7 receptor complex. The natural killer T cells require signals from IL-7RA for their development. The common characteristic of all types of severe combined immunodeficiency (SCID) is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Defects in IL-7RA may be associated with SCID. Meanwhile, single nucleotide polymorphisms in IL7RA gene are involved in the dysregulation of immune homeostasis and susceptibility to multiple sclerosis (MS). IL-7RA is a receptor for TSLP. TSLP indirectly regulates T cell development by modulating dendritic cell activation[1][3].

In Vitro

Soluble human IL-7RA (.1 μg/mL, 1 μg/mL, and 1 μg/mL; 3 days) reduces IL-7-mediated proliferation and production of IFN-γ of peripheral blood mononuclear cells (PBMCs)[4].

Biological Activity

Immobilized Cynomolgus IL-7 R alpha at 0.25 μg/mL (100 μL/well) can bind Biotinylated human IL-7 (HY-P7045). The ED50 for this effect is < 60 ng/mL.

  • Immobilized Cynomolgus IL‑7 R alpha at 0.25 μg/mL (100 μL/well) can bind Biotinylated human IL-7 (HY-P7045). The ED50 for this effect is 30.04 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

Q38IC7 (E21-P235)

Gene ID
Molecular Construction
N-term
IL-7RA (M1-P235)
Accession # Q38IC7
His
C-term
Protein Length

Partial

Synonyms
Interleukin-7 receptor subunit alpha; IL7R; IL-7R-alpha; CD127
AA Sequence

ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSP

Molecular Weight

Approximately 26.3-50 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD127/IL-7RA Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD127/IL-7RA Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77425
Quantity:
MCE Japan Authorized Agent: