1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors B Cell CD Proteins NK Cell CD Proteins Stem Cell CD Proteins Cytokine Receptors
  4. IL-7 Receptor
  5. CD127/IL-7RA
  6. CD127/IL-7RA Protein, Cynomolgus (HEK293, His)

CD127/IL-7RA Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77425
COA Handling Instructions

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
100 μg $710 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235)[1][2].

Background

IL-7R α-chain (IL-7RA; also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL-7 and other alpha helical cytokines. IL-7RA is almost exclusively expressed by cells of the lymphoid lineage that plays an important role in lymphocyte differentiation, proliferation, and survival.  IL-7RA gene is localised on chromosome 5p13.3[1][2].
The amino acid sequence of human IL-7RA protein has low homology between mouse and rat IL-7RA protein. While, human IL-7RA shares 97% aa sequence identity with monkey IL-7RA protein.
IL-7 is classified as a type 1 short-chain cytokine of the hematopoietin family. Physiologic roles of IL-7 involve modulation of T- and B-cell development and T-cell homeostasis. To perform all pleiotropic functions of IL-7 in immune system, IL-7 binds through a transmembrane receptor, which is formed by heterodimerizing of the common cytokine gamma chain (γc; also known as CD132) and IL-7RA. IL-7RA consists of an extracellular domain, transmembrane region and cytoplasmic tail, that recruits kinases for signal transduction. IL-7RA is organized in eight exons, spanning 18 kb of genomic DNA. The protein has a folding typical for the insertion of a helical cytokine, and it is composed of an intracellular domain (195 aa), a transmembrane domain (25 aa), and an extracellular region (220 aa). The latter shares homology with other members of the type I family of cytokine receptors. Close to the transmembrane domain, the extracellular region of IL-7Ra contains a Trp-Ser-X-Trp-Ser (WSXWS) motif involved in proper folding of the protein. Finally, the extracellular region also contains two fibronectin type III-like domains. Soluble or membrane-bound isoforms of IL-7RA are produced according to the alternative splicing of exon 6 in IL7RA gene. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP)[1][2][3].
IL-7RA associates with γc to form the functional high affinity IL-7 receptor complex. The natural killer T cells require signals from IL-7RA for their development. The common characteristic of all types of severe combined immunodeficiency (SCID) is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Defects in IL-7RA may be associated with SCID. Meanwhile, single nucleotide polymorphisms in IL7RA gene are involved in the dysregulation of immune homeostasis and susceptibility to multiple sclerosis (MS). IL-7RA is a receptor for TSLP. TSLP indirectly regulates T cell development by modulating dendritic cell activation[1][3].

In Vitro

Soluble human IL-7RA (.1 μg/mL, 1 μg/mL, and 1 μg/mL; 3 days) reduces IL-7-mediated proliferation and production of IFN-γ of peripheral blood mononuclear cells (PBMCs)[4].

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

Q38IC7 (M1-P235)

Gene ID

102143679  [NCBI]

Molecular Construction
N-term
IL-7RA (M1-P235)
Accession # Q38IC7
His
C-term
Synonyms
Interleukin-7 receptor subunit alpha; IL7R; IL-7R-alpha; CD127
AA Sequence

MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSP

Molecular Weight

Approximately 26.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD127/IL-7RA Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77425
Quantity:
MCE Japan Authorized Agent: