CD131 Protein, Rat (HEK293, Fc)

The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD131 Protein, Rat (HEK293, Fc) is 440 a.a., with molecular weight of ~80-95 kDa.

CD131, a cell surface receptor, plays a pivotal role in immune response by controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Through the formation of a heterodimeric receptor with various partners such as IL3RA, IL5RA, or CSF2RA, CD131 engages in multiple signaling pathways, including interleukin-3, interleukin-5, and granulocyte-macrophage colony-stimulating factor/CSF2 pathways. In unstimulated conditions, CD131 constitutively interacts with JAK1, and ligand binding leads to JAK1 stimulation, triggering the activation of the JAK-STAT pathway. CD131 forms a heterodimer composed of an alpha and a beta subunit, with the beta subunit being common to the IL3, IL5, and GM-CSF receptors. The GM-CSF receptor complex, involved in signaling, is a dodecamer consisting of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. CD131 further interacts with TMEM102, FCER1G, LYN, and JAK1, contributing to its intricate role in cellular responses.

Rat

HEK293

C-hFc

Q78ZF5 (E29-W440)

171081  [NCBI]

EETVPLKTLQCYNDYIERIICSWADTEDAQGLVNLTLYHWLDKKQPMSCELSEDLMWSECPSSHRCVPRRCVLPYTQFSVSKEDYYSLQPDRDLSIHLVVPLAQHVQPPPPKDISISPSGDHFLLKWSVPLGDAQVSLLSQKDIQFEVAYKQLQDSWEDASSLHTCNLWVTLEPKLFLPNSIYVARVRAQLAPGSSLSGRPSGWSPEVHWDSPTEDKARPQNLQCFFDGIQSLNCSWEVWTKVTDSVSFGLFYSSSPKAGEKKCSPVVKELQASRYTRYHCSLNVSDPAAHSQYTVSVKRLEQGKFIESFNHIQMNPPTLNLTKNRDSYSLHWETQKMSYPFIQHAFQVQYKKKLDRWEDSKTENLNHAHSMDLPQLEPGTSYCARVRVKTIPEYKGLWSEWSNECTWTTDW

Approximately 80-95 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.