CD131 Protein, Rat (HEK293, Fc)
Based on 1 Customer Validation
The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD131, a cell surface receptor, plays a pivotal role in immune response by controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Through the formation of a heterodimeric receptor with various partners such as IL3RA, IL5RA, or CSF2RA, CD131 engages in multiple signaling pathways, including interleukin-3, interleukin-5, and granulocyte-macrophage colony-stimulating factor/CSF2 pathways. In unstimulated conditions, CD131 constitutively interacts with JAK1, and ligand binding leads to JAK1 stimulation, triggering the activation of the JAK-STAT pathway. CD131 forms a heterodimer composed of an alpha and a beta subunit, with the beta subunit being common to the IL3, IL5, and GM-CSF receptors. The GM-CSF receptor complex, involved in signaling, is a dodecamer consisting of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. CD131 further interacts with TMEM102, FCER1G, LYN, and JAK1, contributing to its intricate role in cellular responses.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Recombinant Human CD131 binds Recombinant Human GM-CSF in the presence of Recombinant Human GM-CSF R alpha (1 μg/mL). The ED50 for this effect is 65.39 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q78ZF5 (E29-W440)
-
Molecular Construction
-
N-term
-
CD131 (E29-W440)
Accession # Q78ZF5 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CSF2RB; Beta Common Cytokine Receptor; Prev. IL3RB; CDw131; IL5RB; Interleukin 3 Receptor/Granulocyte-Macrophage Colony Stimulating Factor 3 Receptor, Beta (High Affinity); GM-CSF/IL-3/IL-5 Receptor Common Beta Subunit; Colony-Stimulating Factor-2 Recepto
-
AA Sequence
EETVPLKTLQCYNDYIERIICSWADTEDAQGLVNLTLYHWLDKKQPMSCELSEDLMWSECPSSHRCVPRRCVLPYTQFSVSKEDYYSLQPDRDLSIHLVVPLAQHVQPPPPKDISISPSGDHFLLKWSVPLGDAQVSLLSQKDIQFEVAYKQLQDSWEDASSLHTCNLWVTLEPKLFLPNSIYVARVRAQLAPGSSLSGRPSGWSPEVHWDSPTEDKARPQNLQCFFDGIQSLNCSWEVWTKVTDSVSFGLFYSSSPKAGEKKCSPVVKELQASRYTRYHCSLNVSDPAAHSQYTVSVKRLEQGKFIESFNHIQMNPPTLNLTKNRDSYSLHWETQKMSYPFIQHAFQVQYKKKLDRWEDSKTENLNHAHSMDLPQLEPGTSYCARVRVKTIPEYKGLWSEWSNECTWTTDW
-
Molecular Weight
Approximately 123 kDa & 89 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
