1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. TNF Receptor Superfamily 4-1BB/CD137
  5. 4-1BB
  6. CD137/4-1BB Protein, Cynomolgus (HEK293, Fc)

CD137/4-1BB Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P7810
Handling Instructions

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD137/4-1BB Protein, Cynomolgus (HEK293, Fc) is 163 a.a., with molecular weight of ~60.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD137/4-1BB Protein, Cynomolgus (HEK293, Fc) is 163 a.a., with molecular weight of ~60.0 kDa.

Background

CD137/4-1BB Protein exhibits a lack of conserved residue(s) essential for the propagation of feature annotation.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

A9YYE7 (L24-Q186)

Gene ID

102127961  [NCBI]

Molecular Construction
N-term
4-1BB (L24-Q186)
Accession # A9YYE7
hFc
C-term
Synonyms
rCynCD137/4-1BB, Fc; CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
AA Sequence

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Molecular Weight

Approximately 60.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD137/4-1BB Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P7810
Quantity:
MCE Japan Authorized Agent: