1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P7810
Handling Instructions Technical Support

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD137/4-1BB Protein lacks conserved residue(s) crucial for feature annotation propagation. CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD137/4-1BB Protein exhibits a lack of conserved residue(s) essential for the propagation of feature annotation.

In Vitro

4-1BB (Cynomolgus monkey) binds to STA551, and Uto-hIgG2 with Kd value of 25.1 nM and 130 nM, respectively[4].

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

A9YYE7/F6W5G6 (L24-Q186)

Gene ID

102127961  [NCBI]/708281

Molecular Construction
N-term
4-1BB (L24-Q186)
Accession # A9YYE7
hFc
C-term
Protein Length

Partial

Synonyms
rCynCD137/4-1BB, Fc; CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
AA Sequence

LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ

Predicted Molecular Mass
44.4 kDa
분자량

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD137/4-1BB Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P7810
수량:
MCE Japan Authorized Agent: