1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. CD137/4-1BB Protein, Canine (HEK293, Fc)

4-1BB is a surface glycoprotein that belongs to the tumor necrosis factor (TNF) receptor superfamily. CD137 promotes apoptosis of endothelial cells (ECs) by inhibiting Nrf2 pathway and up-regulating NF-κB pathway. 4-1BB can be used in anti-tumor research. CD137/4-1BB Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BB is a surface glycoprotein that belongs to the tumor necrosis factor (TNF) receptor superfamily. CD137 promotes apoptosis of endothelial cells (ECs) by inhibiting Nrf2 pathway and up-regulating NF-κB pathway. 4-1BB can be used in anti-tumor research. CD137/4-1BB Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD137/4-1BB protein, expressed by HEK293 , with C-hFc labeled tag.

Background

4-1BB is encoded by TNFRSF9 (CD137, ILA) and belongs to the tumor necrosis factor (TNF) receptor superfamily. 4-1BB is a surface glycoprotein that is expressed in a variety of cells, such as T cells, B cells, natural killer cells (NK), dendritic cells (DC), eosinophils and mast cells, as well as a variety of tumor cells, such as human leukemia cells. 4-1BB provides a co-stimulatory signal that activates the cytotoxic effects of CD8+ T cells and helps form memory T cells that promote the immune system to fight tumors. CD137 binds to CD137L to signal monocytes to increase their survival, and proliferation, and stimulate their migration and exosmosis. It also induces the release of a variety of pro-inflammatory factors, resulting in a large influx of inflammatory monocytes into tissues, forming an inflammatory environment. CD137 promotes the migration of mononuclear/macrophage cells to the tumor microenvironment by up-regulating Fra1 expression. At the same time, it also promoted the differentiation of mononuclear/macrophage cells into osteoclasts, providing a good microenvironment for breast cancer cells to colonize and grow in bone. It offers a promising treatment strategy for breast cancer metastasis. CD137 promotes apoptosis of endothelial cells (ECs) by inhibiting Nrf2 pathway and up-regulating NF-κB pathway[1][2][3].

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

XP_850336.1 (I24-S185)

Gene ID
Molecular Construction
N-term
4-1BB (I24-S185)
Accession # XP_850336.1
hFc
C-term
Protein Length

Partial

Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137
AA Sequence

IQDSCSKCPAGTFCGKNKSQICIPCPPNSFSSTSGQKACDICRQCEGVFRTKKVCSPISNAECECISGFHCLGAGCTMCEQDCKQGQELTKQGCKDCRFGTFNDQKHGICQPWTNCSLDGKSVLVNGTKESDAVCGPASAGFSPGTASATTPAPARDPGHTS

Predicted Molecular Mass
43.9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD137/4-1BB Protein, Canine (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD137/4-1BB Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P75609
Quantity:
MCE Japan Authorized Agent: