CD14 Protein, Mouse (HEK293, His)

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.

CD14 encodes a protein pivotal in the innate immune response and prominently expressed in monocyte/macrophage cells. Functioning as a co-receptor, it binds various microbial and fungal molecules, including lipopolysaccharides (LPS). The LPS-binding activity of this protein is potentiated by the LPS binding protein (LBP), facilitating binding to the TLR4-MD-2 co-receptor complex. CD14 exists in two forms—soluble and cell surface-anchored by a glycosylphosphatidylinositol anchor. Its broad expression is observed across diverse tissues, such as the mammary gland and colon, highlighting its crucial role in immune-related processes.

Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED₅₀ this effect is 1.121 μg/mL, corresponding to a specific activity is 892.06 U/mg.

• 
  Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED₅₀ this effect is 1.121 μg/mL, corresponding to a specific activity is 892.06 U/mg.

Mouse

HEK293

C-6*His

P10810/NP_033971.1 (S16-P345)

12475  [NCBI]

Partial

SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.