CD14 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag.
CD14 encodes a protein pivotal in the innate immune response and prominently expressed in monocyte/macrophage cells. Functioning as a co-receptor, it binds various microbial and fungal molecules, including lipopolysaccharides (LPS). The LPS-binding activity of this protein is potentiated by the LPS binding protein (LBP), facilitating binding to the TLR4-MD-2 co-receptor complex. CD14 exists in two forms—soluble and cell surface-anchored by a glycosylphosphatidylinositol anchor. Its broad expression is observed across diverse tissues, such as the mammary gland and colon, highlighting its crucial role in immune-related processes.
Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 1.121 μg/mL, corresponding to a specific activity is 892.06 U/mg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P10810/NP_033971.1 (S16-P345)
-
Molecular Construction
-
N-term
-
CD14 (S16-P345)
Accession # P10810/NP_033971.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen
-
AA Sequence
SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
