CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
CD150/SLAMF1, a self-ligand receptor belonging to the signaling lymphocytic activation molecule (SLAM) family, plays a pivotal role in modulating the activation and differentiation of various immune cells, thereby contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of CD150 are regulated by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150 induces distinct signal transduction events in T-lymphocytes compared to B-cells, involving two modes of signaling—one dependent on SH2D1A (and possibly SH2D1B) and another reliant on protein-tyrosine phosphatase 2C (PTPN11). CD150 mediates IL-2-independent proliferation of activated T-cells, induces IFN-gamma production, and participates in downstream signaling pathways involving INPP5D, DOK1, DOK2, PRKCQ, BCL10, and NFKB1. Furthermore, it plays crucial roles in the differentiation of T follicular helper cells, the regulation of allergic responses, and the modulation of innate immune responses against Gram-negative bacteria in macrophages. Additionally, CD150 acts as a receptor for Measles virus, including isoform 4.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q13291-1 (A21-P237)
-
Molecular Construction
-
N-term
-
SLAMF1 (A21-P237)
Accession # Q13291-1 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
SLAMF1; IPO-3; Prev. SLAM; CDw150; Signaling Lymphocytic Activation Molecule; IPO3; CD150; CD150 Antigen; Signaling Lymphocytic Activation Molecule Family Member 1; SLAM Family Member 1
-
AA Sequence
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
-
Predicted Molecular Mass
27.1 kDa
-
Molecular Weight
Approximately 42-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)