CD162/PSGL-1 Protein, Human (254a.a, HEK293, Fc)

CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (254a.a, HEK293, Fc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293, with C-hFc labeled tag. The total length of CD162/PSGL-1 Protein, Human (254a.a, HEK293, Fc) is 254 a.a., with molecular weight of 100-130 kDa.

CD162/PSGL-1 Protein is a SLe(x)-type proteoglycan that plays a crucial role in inflammation. It facilitates the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation by interacting with E-, P-, and L-selectins through high affinity, calcium-dependent interactions. CD162/PSGL-1 Protein is essential for the initial capture of leukocytes. In addition to its role in inflammation, it also acts as a receptor for enterovirus 71 during microbial infection.

Human

HEK293

C-hFc

Q14242 (Q42-G295)

6404  [NCBI]

QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG

100-130 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.