CD2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD2, a cell surface glycoprotein, is involved in identical protein binding activity and plays a crucial role in various immune processes. Predicted to participate in T cell activation, heterotypic cell-cell adhesion, and positive regulation of cytokine production, CD2 is primarily located in cellular components such as cell-cell junctions and the external side of the plasma membrane. As an anchored component of the plasma membrane, CD2 exhibits biased expression in tissues related to the immune system, including the thymus and spleen, with notable expression levels, such as RPKM 30.1 and RPKM 18.0, respectively, indicating its significance in immune function and regulation.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/ml, corresponding to a specific activity is 2.607×10^3 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/mL, corresponding to a specific activity is 2.607×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD2 (R23-S203, M128V, N175S, M192J)
      Accession # NP_038514.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD2; Rosette Receptor; Prev. SRBC; LFA-2; T-Cell Surface Antigen CD2; Lymphocyte-Function Antigen-2; CD2 Antigen (P50), Sheep Red Blood Cell Receptor; CD2 Antigen; T-Cell Surface Antigen T11/Leu-5; T11; Erythrocyte Receptor; CD2 Molecule; LFA-3 Receptor

  • AA Sequence

    MKCKFLGSFFLLFSLSGKGADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

  • Predicted Molecular Mass

    22 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00