1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD2
  5. CD2 Protein, Mouse (HEK293, His)

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD2 Protein, Mouse (HEK293, His) is 181 a.a., with molecular weight of approximately 33.79 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

CD2 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD2 Protein, Mouse (HEK293, His) is 181 a.a., with molecular weight of approximately 33.79 kDa.

Background

CD2, a cell surface glycoprotein, is involved in identical protein binding activity and plays a crucial role in various immune processes. Predicted to participate in T cell activation, heterotypic cell-cell adhesion, and positive regulation of cytokine production, CD2 is primarily located in cellular components such as cell-cell junctions and the external side of the plasma membrane. As an anchored component of the plasma membrane, CD2 exhibits biased expression in tissues related to the immune system, including the thymus and spleen, with notable expression levels, such as RPKM 30.1 and RPKM 18.0, respectively, indicating its significance in immune function and regulation.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/ml, corresponding to a specific activity is 2.607×10^3 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/mL, corresponding to a specific activity is 2.607×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

NP_038514.1 (R23-S203)

Gene ID
Molecular Construction
N-term
CD2 (R23-S203)
Accession # NP_038514.1
10*His
C-term
Synonyms
T-cell surface antigen CD2; LFA-3 receptor; LFA-2; CD2; SRBC
AA Sequence

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

Molecular Weight

approximately 33.79 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74323
Quantity:
MCE Japan Authorized Agent: