CD2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.
CD2, a cell surface glycoprotein, is involved in identical protein binding activity and plays a crucial role in various immune processes. Predicted to participate in T cell activation, heterotypic cell-cell adhesion, and positive regulation of cytokine production, CD2 is primarily located in cellular components such as cell-cell junctions and the external side of the plasma membrane. As an anchored component of the plasma membrane, CD2 exhibits biased expression in tissues related to the immune system, including the thymus and spleen, with notable expression levels, such as RPKM 30.1 and RPKM 18.0, respectively, indicating its significance in immune function and regulation.
Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/ml, corresponding to a specific activity is 2.607×10^3 units/mg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
NP_038514.1 (R23-S203, M128V, N175S, M192J)
-
Molecular Construction
-
N-term
-
CD2 (R23-S203, M128V, N175S, M192J)
Accession # NP_038514.1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD2; Rosette Receptor; Prev. SRBC; LFA-2; T-Cell Surface Antigen CD2; Lymphocyte-Function Antigen-2; CD2 Antigen (P50), Sheep Red Blood Cell Receptor; CD2 Antigen; T-Cell Surface Antigen T11/Leu-5; T11; Erythrocyte Receptor; CD2 Molecule; LFA-3 Receptor
-
AA Sequence
MKCKFLGSFFLLFSLSGKGADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
