CD20/MS4A1 Protein, Human (Trx-His, Solution)

CD20/MS4A-1 Protein,Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

CD20 is an non-glycosylated protein expressed on the surface of normal and malignant B lymphocytes, and belongs to the MS4A (membrane-spanning 4-domain family A) protein family. Human cluster of differentiation 20 (CD20) is an integral membrane protein expressed during B lymphocyte development. CD20 it is involved in intracellular calcium signaling associated with the B cell receptor. CD20 is also expressed in malignant B cells and is the target of approved therapeutic monoclonal antibodies (mAbs), which are divided into two groups, type I and type II, on the basis of two signature differences: Type I mAbs recruit complement more potently than type II mAbs and therefore induce robust complement-dependent cytotoxicity (CDC); type I mAbs bind twice as many type II mAbs to a given B cell type^[1][2].

Data is not available.

Human

E. coli

N-6*His;N-Trx

P11836 (I141-S188)

931  [NCBI]

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

18-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369(6505):793-799.  [Content Brief]

  [2]. Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105(6):1494-1506.  [Content Brief]