CD20/MS4A1 Protein, Human (Trx-His, Solution)
Based on 1 Customer Validation
CD20/MS4A-1 Protein,Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD20/MS4A-1 Protein,Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.
Background
CD20 is an non-glycosylated protein expressed on the surface of normal and malignant B lymphocytes, and belongs to the MS4A (membrane-spanning 4-domain family A) protein family. Human cluster of differentiation 20 (CD20) is an integral membrane protein expressed during B lymphocyte development. CD20 it is involved in intracellular calcium signaling associated with the B cell receptor. CD20 is also expressed in malignant B cells and is the target of approved therapeutic monoclonal antibodies (mAbs), which are divided into two groups, type I and type II, on the basis of two signature differences: Type I mAbs recruit complement more potently than type II mAbs and therefore induce robust complement-dependent cytotoxicity (CDC); type I mAbs bind twice as many type II mAbs to a given B cell type[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-Trx
-
Accession
P11836-1 (I141-S188)
-
Molecular Construction
-
N-term
-
Trx-6*His
-
CD20 (I141-S188)
Accession # P11836-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MS4A1; CD20 Antigen; Prev. CD20; B-Lymphocyte Cell-Surface Antigen B1; Bp35; B-Lymphocyte Surface Antigen B1; FMC7; CD20 Receptor; B1; LEU-16; Membrane-Spanning 4-Domains, Subfamily A, Member 1; CVID5; Leukocyte Surface Antigen Leu-16; S7; B-Lymphocyte An
-
AA Sequence
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
-
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369(6505):793-799. [Content Brief]
[2]. Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105(6):1494-1506. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
