1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD20
  5. CD20/MS4A1 Protein, Human (Trx-His, Solution)

CD20/MS4A-1 Protein,Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD20/MS4A-1 Protein,Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

Background

CD20 is an non-glycosylated protein expressed on the surface of normal and malignant B lymphocytes, and belongs to the MS4A (membrane-spanning 4-domain family A) protein family. Human cluster of differentiation 20 (CD20) is an integral membrane protein expressed during B lymphocyte development. CD20 it is involved in intracellular calcium signaling associated with the B cell receptor. CD20 is also expressed in malignant B cells and is the target of approved therapeutic monoclonal antibodies (mAbs), which are divided into two groups, type I and type II, on the basis of two signature differences: Type I mAbs recruit complement more potently than type II mAbs and therefore induce robust complement-dependent cytotoxicity (CDC); type I mAbs bind twice as many type II mAbs to a given B cell type[1][2].

Species

Human

Source

E. coli

Tag

N-6*His;N-Trx

Accession

P11836-1 (I141-S188)

Gene ID

931  [NCBI]

Molecular Construction
N-term
Trx-6*His
CD20 (I141-S188)
Accession # P11836-1
C-term
Synonyms
rHuB-lymphocyte antigen CD20/CD20, Trx-His; MS4A1; CD20; MS4A-1; B1; Bp35; CVID5; LEU-16; MS4A2; S7
AA Sequence

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Weight

18-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD20/MS4A1 Protein, Human (Trx-His, Solution)
Cat. No.:
HY-P7896
Quantity:
MCE Japan Authorized Agent: