1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. B Cell CD Proteins Platelet CD Proteins Epithelial cell CD Proteins Fc-epsilon Receptor
  4. Fc epsilon RII/CD23
  5. CD23/Fc epsilon RII Protein, Mouse (HEK293, His)

CD23/Fc epsilon RII Protein, Mouse (HEK293, His)

Cat. No.: HY-P74321
Handling Instructions Technical Support

CD23/Fc epsilon RII Protein, a low-affinity receptor for IgE and CR2/CD21, regulates IgE production and B cell differentiation. On B cells, it initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, IgE binding induces intracellular killing of parasites through the L-Arginine-nitric oxide pathway. CD23/Fc epsilon RII homotrimer interacts with IGHE to regulate IgE homeostasis and with CR2/CD21 for binding. CD23/Fc epsilon RII Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD23/Fc epsilon RII Protein, a low-affinity receptor for IgE and CR2/CD21, regulates IgE production and B cell differentiation. On B cells, it initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, IgE binding induces intracellular killing of parasites through the L-Arginine-nitric oxide pathway. CD23/Fc epsilon RII homotrimer interacts with IGHE to regulate IgE homeostasis and with CR2/CD21 for binding. CD23/Fc epsilon RII Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-His labeled tag.

Background

The CD23/Fc epsilon RII protein serves as a low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21, playing crucial roles in the regulation of IgE production and B cell differentiation. On B cells, it initiates IgE-dependent antigen uptake and presentation to T cells, contributing to immune response modulation. In macrophages, CD23, upon binding IgE and cross-linking with antigens, triggers intracellular killing of parasites through the activation of the L-Arginine-nitric oxide pathway. Existing as a homotrimer, CD23 interacts with IGHE, regulating IgE homeostasis through its C-type lectin domain. Additionally, CD23 interacts with CR2/CD21 through its C-terminus, forming a connection via the Sushi domains 1 and 2. These interactions underscore the multifaceted involvement of CD23 in immunological processes, influencing both B cell function and macrophage-mediated responses.

Biological Activity

Immobilized recombinant mouse CD23 at 5 μg/ml (100 μl/well) can bind Biotinylated Recombinant mouse IgE Protein. The ED50 for this effect is 0.1294 μg/mL.

  • Immobilized recombinant mouse CD23 at 5 μg/mL (100 μl/well) can bind Biotinylated Recombinant mouse IgE Protein. The ED50 for this effect is 0.1294 μg/mL.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

P20693-1 (E50-P331)

Gene ID
Molecular Construction
N-term
His
CD23 (E50-P331)
Accession # P20693-1
C-term
Protein Length

Extracellular Domain

Synonyms
Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; FCER2; CD23A
AA Sequence

ETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP

분자량

33-43 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD23/Fc epsilon RII Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD23/Fc epsilon RII Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74321
수량:
MCE Japan Authorized Agent: