CD23/Fc epsilon RII Protein, Rat (HEK293, Fc)

CD23, also known as Fc epsilon Receptor II (Fc epsilon RII), is a low-affinity receptor for immunoglobulin E (IgE) and complement receptor 2 (CR2/CD21). CD23 regulates IgE production and B-cell differentiation, aiding in IGE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD23/Fc epsilon RII protein, expressed by HEK293 , with N-hFc labeled tag.

CD23, also known as Fc epsilon Receptor II (Fc epsilon RII), is a low-affinity receptor for immunoglobulin E (IgE) and complement receptor 2 (CR2/CD21). CD23 on B cells plays a crucial role in the regulation of IgE production and B cell differentiation, promoting the uptake and presentation of IGE-dependent antigens to T cells. In macrophages, IgE binding and antigenic crosslinking trigger the parasite's intracellular killing by activating the L-arginine-nitric oxide pathway. CD23 forms homologous trimers and interacts with IGHE, particularly through its C-type lectin domain, regulating IgE homeostasis. CD23 plays an important role in immune responses ranging from B-cell activation to macrophage-mediated parasite defense^[1][2].

Measured by its binding ability in a functional ELISA. Immobilized Rat CD23 at 2μg/mL (100μL/well) can bind Human IgE. The ED₅₀ for this effect is 0.5997 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat CD23 at 2 μg/mL (100μL/well) can bind Human IgE. The ED₅₀ for this effect is 0.5997 μg/mL.

Rat

HEK293

N-hFc

Q6AZ45 (E50-P331)

171075  [NCBI]

Extracellular Domain

ETEKSLKQLGDAAIQNVSHVTKDLQNYQSNQLAQKSQALQMSQNLEELQAEQKQMKSQDSQLSQNLNELQEDLINVKSQNSELSQNLNTLQEDLVNVKSQGLNEKRAASDSLEKLQEEVAKLWIEILMSKGTACNVCPKDWLHFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHINKKESWIGLQDLNMEGEFVWPDGSPVGYSNWSPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCDLSAPLASVTPTGPTPKNEP

Approximately 60-75 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.