CD28 Protein, Rhesus Macaque (HEK293, Fc)

The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD28 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD28 Protein, Rhesus Macaque (HEK293, Fc) is 134 a.a., with molecular weight of 55-77 kDa.

CD28 protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules, including DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2. Isoform 3 specifically interacts with CD40LG, highlighting its multifaceted role in mediating immune responses and cellular signaling pathways.

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque CD28 is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human B7-1. The ED₅₀ for this effect is 201.9 ng/mL.

Rhesus Macaque

HEK293

C-hFc

Q0PDN4 (N19-P152)

705313  [NCBI]

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Approximately 55-77 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.