CD28 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.
CD28 Protein plays a crucial role in T-cell activation by inducing cell proliferation, cytokine production, and promoting T-cell survival. It works in conjunction with TCR/CD3 ligation and CD40L costimulation to enhance the production of IL4 and IL10 in T-cells. CD28 Protein forms a homodimer through disulfide-linkage and interacts with DUSP14. Additionally, it binds to CD80/B7-1 and CD86/B7-2/B70, and has an interaction with GRB2 (By similarity).
Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED50 for this effect is 955.5 ng/mL.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P31042 (N20-K149)
-
Molecular Construction
-
N-term
-
CD28 (N20-K149)
Accession # P31042 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)
-
AA Sequence
NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK
-
Molecular Weight
Approximately 30-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
