CD28 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD28 Protein plays a crucial role in T-cell activation by inducing cell proliferation, cytokine production, and promoting T-cell survival. It works in conjunction with TCR/CD3 ligation and CD40L costimulation to enhance the production of IL4 and IL10 in T-cells. CD28 Protein forms a homodimer through disulfide-linkage and interacts with DUSP14. Additionally, it binds to CD80/B7-1 and CD86/B7-2/B70, and has an interaction with GRB2 (By similarity).

Verified Bioactivity

Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED50 for this effect is 955.5 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED50 for this effect is 955.5 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD28 (N20-K149)
      Accession # P31042
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)

  • AA Sequence

    NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK

  • Molecular Weight

    Approximately 30-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00