CD28 Protein, Mouse (Biotinylated , HEK293, His)
CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity). CD28 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity). CD28 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD28 Protein, a key player in T-cell activation, is involved in inducing cell proliferation, cytokine production, and promoting T-cell survival. It enhances the production of IL4 and IL10 in T-cells when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a homodimer through disulfide-linkage and interacts with DUSP14. It binds to CD80/B7-1 and CD86/B7-2/B70, and also has an interaction with GRB2 (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P31041 (N20-K149)
-
Molecular Construction
-
N-term
-
CD28 (N20-K149)
Accession # P31041 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)
-
AA Sequence
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 32-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
