1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD28
  5. CD28 Protein, Rat (HEK293, Fc)

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD28 Protein plays a crucial role in T-cell activation by inducing cell proliferation, cytokine production, and promoting T-cell survival. It works in conjunction with TCR/CD3 ligation and CD40L costimulation to enhance the production of IL4 and IL10 in T-cells. CD28 Protein forms a homodimer through disulfide-linkage and interacts with DUSP14. Additionally, it binds to CD80/B7-1 and CD86/B7-2/B70, and has an interaction with GRB2 (By similarity).

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD28 at 1 μg/mL (100 μL/Well) can bind biotinylated B7-1 (HY-P78382). The ED50 for this effect is 2.729 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat CD28 at 1 μg/mL (100 μL/Well) can bind biotinylated B7-1 (HY-P78382). The ED50 for this effect is 2.729 μg/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P31042/EDL98926.1 (N20-K149)

Gene ID
Molecular Construction
N-term
CD28 (N20-K149)
Accession # P31042/EDL98926.1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
CD28; T-cell-specific surface glycoprotein CD28; Tp44
AA Sequence

NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK

분자량

Approximately 42 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD28 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD28 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74310
수량:
MCE Japan Authorized Agent: