CD3 epsilon Protein, Rat (HEK293, Fc)

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation^[1]. CD3 epsilon Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD3 epsilon Protein, Rat (HEK293, Fc) is 80 a.a., with molecular weight of ~36.1 KDa.

The CD3 epsilon protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. The CD3D/CD3E and CD3G/CD3E heterodimers form trimers with TCRalpha and TCRbeta, completing the TCR-CD3 complex. CD3E's interactions with CD6 and NCK1 highlight its multifaceted role in T-cell responses^[1].

Immobilized Rat CD3 epsilon at 1 μg/mL (100 μL/well) can bind anti-CD3. The ED50 for this effect is 3.715 ng/mL.

• 
  Immobilized Rat CD3 epsilon at 1 μg/mL (100 μL/well) can bind anti-CD3, The ED50 for this effect is 3.715 ng/mL.

Rat

HEK293

C-hFc

NP_001101610.1 (Y24-D103)

315609  [NCBI]

YEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVD

Approximately 36.1 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.