1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Rat (HEK293, Fc)

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. CD3 epsilon Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD3 epsilon Protein, Rat (HEK293, Fc) is 80 a.a., with molecular weight of ~36.1 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation[1]. CD3 epsilon Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD3 epsilon Protein, Rat (HEK293, Fc) is 80 a.a., with molecular weight of ~36.1 KDa.

Background

The CD3 epsilon protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. The CD3D/CD3E and CD3G/CD3E heterodimers form trimers with TCRalpha and TCRbeta, completing the TCR-CD3 complex. CD3E's interactions with CD6 and NCK1 highlight its multifaceted role in T-cell responses[1].

Biological Activity

Immobilized Rat CD3 epsilon at 1 μg/mL (100 μL/well) can bind anti-CD3. The ED50 for this effect is 3.715 ng/mL.

  • Immobilized Rat CD3 epsilon at 1 μg/mL (100 μL/well) can bind anti-CD3, The ED50 for this effect is 3.715 ng/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

NP_001101610.1 (Y24-D103)

Gene ID
Molecular Construction
N-term
CD3 epsilon (Y24-D103)
Accession # NP_001101610.1
hFc
C-term
Synonyms
T-Cell Surface Glycoprotein CD3 Epsilon Chain; T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e; CD3E; T3E
AA Sequence

YEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVD

Molecular Weight

Approximately 36.1 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76788
Quantity:
MCE Japan Authorized Agent: