1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD300c
  5. CD300c Protein, Human (HEK293, His)

CD300c protein, also known as CMRF35 antigen, was identified using a monoclonal antibody. It is present on immune cells like monocytes, neutrophils, and certain T and B lymphocytes, as documented by Jackson et al. in 1992. The protein is broadly expressed in various tissues, including the lung, appendix, and 19 other tissues. CD300c Protein, Human (HEK293, His) is the recombinant human-derived CD300c protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CD300c protein, also known as CMRF35 antigen, was identified using a monoclonal antibody. It is present on immune cells like monocytes, neutrophils, and certain T and B lymphocytes, as documented by Jackson et al. in 1992. The protein is broadly expressed in various tissues, including the lung, appendix, and 19 other tissues. CD300c Protein, Human (HEK293, His) is the recombinant human-derived CD300c protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD300c protein, also known as the CMRF35 antigen, has been identified through reactivity with a monoclonal antibody. This antigen is found on various immune cells, including monocytes, neutrophils, and certain T and B lymphocytes, as documented in a study by Jackson et al. in 1992. The protein exhibits broad expression across multiple tissues, with notable presence in lung, appendix, and 19 other tissues.

Biological Activity

Measured by its ability to inhibit anti-CD3-induced proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 3.884 μg/ml, corresponding to a specific activity is 257.47 units/mg.

  • Measured by its ability to inhibit anti-CD3-induced proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 3.884 μg/mL, corresponding to a specific activity is 257.47 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q08708/NP_006669.1 (M29-R183)

Gene ID
Molecular Construction
N-term
CD300c (M29-R183)
Accession # Q08708/NP_006669.1
His
C-term
Protein Length

Partial

Synonyms
CMRF35-like molecule 6; CLM-6; CMRF35-A1; CMRF-35; IGSF16
AA Sequence

MTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

분자량

29-40 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD300c Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD300c Protein, Human (HEK293, His)
Cat. No.:
HY-P76222
수량:
MCE Japan Authorized Agent: