CD34 Protein, Mouse (HEK293, His)

CD34 protein functions as a potential adhesion molecule, aiding early hematopoiesis by facilitating stem cell attachment to the bone marrow extracellular matrix or stromal cells. It acts as a scaffold for lineage-specific glycans, enabling stem cells to bind to lectins on stromal cells or other marrow components. Moreover, CD34 may present carbohydrate ligands to selectins, contributing to cell adhesion processes. CD34 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD34 protein, expressed by HEK293 , with C-His labeled tag.

CD34 protein is a possible adhesion molecule implicated in early hematopoiesis, facilitating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. It is suggested to function as a scaffold for the attachment of lineage-specific glycans, enabling stem cells to bind to lectins expressed by stromal cells or other marrow components. Additionally, CD34 may play a role in presenting carbohydrate ligands to selectins, contributing to cell adhesion processes.

Mouse

HEK293

C-His

Q64314 (T35-T287)

12490  [NCBI]

Extracellular Domain

TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.