CD36 Protein, Human (HEK293, His-Avi)
Based on 1 Customer Validation
CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
CD36 is a versatile glycoprotein serving as a receptor for a diverse array of ligands, encompassing proteinaceous entities like thrombospondin, fibronectin, collagen, or amyloid-beta, as well as lipidic components such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids, and bacterial diacylated lipopeptides. Exhibiting multivalency, these ligands can engage multiple receptors simultaneously, prompting the formation of CD36 clusters that initiate signal transduction and the internalization of receptor-ligand complexes. The dependency on coreceptor signaling is notably ligand specific. Cellular responses to these ligands play pivotal roles in angiogenesis, inflammatory responses, fatty acid metabolism, taste, and dietary fat processing in the intestine. Additionally, CD36 binds long-chain fatty acids, facilitating their transport into cells and participating in muscle lipid utilization, adipose energy storage, and gut fat absorption. Mechanistically, fatty acid binding activates downstream kinase LYN, phosphorylating palmitoyltransferase ZDHHC5 and leading to CD36 depalmitoylation and caveolar endocytosis. In the small intestine, CD36 plays a role in the proximal absorption of dietary fatty acids and cholesterol, potentially through the activation of the MAPK1/3 (ERK1/2) signaling pathway. It is also involved in oral fat perception and preferences, mediating intracellular calcium level increases in taste receptor cells. Furthermore, CD36 is a significant factor in ventromedial hypothalamus neuronal sensing of long-chain fatty acids and the regulation of energy and glucose homeostasis. Acting as a receptor for thrombospondins, CD36 mediates their antiangiogenic effects and induces apoptosis in podocytes in response to elevated free fatty acids, in collaboration with THBS1. As a coreceptor for TLR4:TLR6 heterodimer, CD36 promotes inflammation in monocytes/macrophages upon ligand binding, leading to NF-kappa-B-dependent cytokine production and IL1B secretion through the priming and activation of the NLRP3 inflammasome. Furthermore, CD36 serves as a selective and nonredundant sensor of microbial diacylated lipopeptides, triggering NF-kappa-B-dependent TNF production and subsequent Golgi targeting in a lipid-raft dependent pathway through TLR2:TLR6 heterodimer signaling. In the context of microbial infection, CD36 directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling.
Immobilized Human CD36, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-CD36 Antibody, hFc Tag with the EC50 of 0.5-1.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P16671-1 (G30-N439)
-
Molecular Construction
-
N-term
-
CD36 (G30-N439)
Accession # P16671-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD36; Leukocyte Differentiation Antigen CD36; CD36 Molecule (CD36 Blood Group); Thrombospondin Receptor; Platelet Glycoprotein 4; CD36 Antigen; GPIIIB; PAS-4; GPIV; CD36 Molecule (CD36 Blood Group) Transcript; GP3B; Scavenger Receptor Class B, Member 3; F
-
AA Sequence
GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN
-
Predicted Molecular Mass
49.5 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)