CD38 Protein, Rat (HEK293, Fc)

CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer. Its cADPR hydrolase activity adds to its versatility. Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation. CD38 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD38 Protein, Rat (HEK293, Fc) is 259 a.a., with molecular weight of ~67 kDa.

The CD38 protein performs multiple essential functions. It is responsible for synthesizing two crucial second messengers, cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate. Cyclic ADP-ribose acts as a second messenger for glucose-induced insulin secretion, while nicotinate-adenine dinucleotide phosphate functions as a calcium mobilizer. CD38 also possesses cADPR hydrolase activity, adding to its functional repertoire. Additionally, CD38 regulates osteoclastic bone resorption, most likely through the production of cyclic ADP-ribose and the initiation of a calcium ion signal via activation of the ryanodine receptor.

Rat

HEK293

C-hFc

Q64244 (W45-V303)

25668  [NCBI]

WPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV

Approximately 67 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.