CD39 Protein, Mouse (HEK293, His)

The CD39 protein, expressed in the nervous system, regulates purinergic neurotransmission by hydrolyzing ATP and other nucleotides. It also prevents platelet aggregation by hydrolyzing platelet-activating ADP to AMP. CD39's proficiency in hydrolyzing both ATP and ADP underscores its versatile role in modulating purinergic signaling, influencing neurotransmission and platelet function. Its dual enzymatic activity maintains the delicate balance of purinergic signaling in the nervous system and hemostasis. CD39 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD39 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD39 Protein, Mouse (HEK293, His) is 441 a.a., with molecular weight of 60-90 kDa.

CD39 protein, prominently expressed in the nervous system, plays a crucial role in the regulation of purinergic neurotransmission by hydrolyzing ATP and other nucleotides. Additionally, CD39 is implicated in preventing platelet aggregation through the hydrolysis of platelet-activating ADP to AMP. Notably, CD39 exhibits equal proficiency in hydrolyzing both ATP and ADP, underscoring its versatility in modulating purinergic signaling pathways and contributing to regulatory mechanisms that influence neurotransmission and platelet function. The dual enzymatic activity of CD39 highlights its significance in maintaining the delicate balance of purinergic signaling within the nervous system and the broader context of hemostasis.

Mouse

HEK293

C-6*His

P55772(T38-I478)

12495  [NCBI]

TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI

60-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl,500 mM NaCl, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.