CD3D-CD3E Heterodimer Protein, Cynomolgus (HEK293, Fc-Flag&Fc-His)

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3D-CD3E Heterodimer Protein, Cynomolgus (HEK293, Fc-Flag&Fc-His) is a recombinant protein dimer complex containing cynomolgus-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-hFc, C-Flag, C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Cynomolgus (HEK293, Fc-Flag&Fc-His), has molecular weight of 40-60 kDa.

CD3 delta Protein, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, is crucial for the adaptive immune response. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. When engaged by the TCR, these motifs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, initiating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable for thymocyte differentiation, contributing to the accurate assembly and surface expression of the TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes struggle with proper differentiation. CD3D interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8, essential for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. This hexamer interacts with CD3Z homodimers, forming the complete TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be substituted by TCRgamma and TCRdelta. CD3D's intricate interactions underscore its pivotal role in orchestrating T-cell responses.

Cynomolgus

HEK293

C-hFc;C-Flag;C-6*His

Q95LI8 (F22-A105)&Q95LI5 (Q22-D117)

102133701  [NCBI]&102133065  [NCBI]

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA&QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

40-60 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.