Copy Link Print Information

CD55/DAF Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, His) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD55/DAF Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CD55/DAF protein is critical in the immune system, recognizing C4b and C3b fragments, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. This regulatory mechanism alleviates complement-induced damage by inhibiting complement activation. CD55/DAF Protein, Human (HEK293, His) is the recombinant human-derived CD55/DAF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD55/DAF Protein plays a crucial role in the immune system by recognizing C4b and C3b fragments generated during C4 and C3 activation. Its interaction with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. This interference serves as a regulatory mechanism, inhibiting complement activation and preventing the formation of C3 and C5 convertases, thereby mitigating complement-induced damage. Notably, CD55/DAF also acts as a receptor for Coxsackievirus A21, as well as coxsackieviruses B1, B3, and B5 during microbial infection, highlighting its diverse roles in immune regulation and viral recognition.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P08174 (D35-S353)

  • Gene ID
    1604  [NCBI]
  • Molecular Construction
    • N-term
    • DAF (D35-S353)
      Accession # P08174
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CD55; CD55 Molecule, Decay Accelerating Factor For Complement (Cromer Blood Group); Prev. DAF; Rh Blood Group D Antigen; CROM; CD55 Antigen; CR; CD55 Antigen, Decay Accelerating Factor For Complement (Cromer Blood Group), Isoform CRA_d; Complement Decay-A

  • AA Sequence

    DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS

  • Predicted Molecular Mass

    36 kDa

  • Molecular Weight

    Approximately 50-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD55/DAF Protein, Human (HEK293, His) Product Image
    1/16
  • CD55/DAF Protein, Human (HEK293, His) Product Image