CD55/DAF Protein, Mouse (361a.a, HEK293, His)

The CD55/DAF protein is critical in the immune system and recognizes C4b and C3b fragments. It interacts with cell-associated C4b and C3b, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. CD55/DAF Protein, Mouse (361a.a, HEK293, His) is the recombinant mouse-derived CD55/DAF protein, expressed by HEK293 , with C-His labeled tag. The total length of CD55/DAF Protein, Mouse (361a.a, HEK293, His) is 361 a.a., with molecular weight of ~60 kDa.

CD55/DAF Protein plays a crucial role in the immune system by recognizing C4b and C3b fragments generated during C4 and C3 activation. Its interaction with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. This interference serves as a regulatory mechanism, inhibiting complement activation and preventing the formation of C3 and C5 convertases, thereby mitigating complement-induced damage. CD55/DAF's ability to recognize and modulate complement components underscores its crucial role in immune regulation and the protection of host cells from complement-mediated harm.

Mouse

HEK293

C-His

Q61475 (M1-T361)

13136  [NCBI]

MIRGRAPRTRPSPPPPLLPLLSLSLLLLSPTVRGDCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT

Approximately 60 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.