CD63 Protein, Mouse (GST)
Based on 1 Customer Validation
The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.
The CD63 Protein functions as a cell surface receptor for TIMP1 and plays a crucial role in activating diverse cellular signaling cascades. It is involved in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Through its participation in these signaling pathways, CD63 promotes cell survival, orchestrates the reorganization of the actin cytoskeleton, facilitates cell adhesion, spreading, and migration. Additionally, it contributes to VEGFA signaling by regulating the internalization of KDR/VEGFR2. CD63 is indispensable for intracellular vesicular transport processes and is vital for the normal trafficking of the PMEL luminal domain, essential for the development and maturation of melanocytes. Furthermore, CD63 plays a role in the adhesion of leukocytes onto endothelial cells by regulating SELP trafficking. While it may be involved in mast cell degranulation in response to Ms4a2/FceRI stimulation, it does not participate in mast cell degranulation in response to other stimuli. CD63 engages in interactions with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, being essential for recruiting KDR to ITGB1 complexes, underlining its intricate involvement in various cellular processes. Additionally, CD63 interacts with SYT7.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-GST
-
Accession
P41731 (A103-I203)
-
Molecular Construction
-
N-term
-
GST
-
CD63 (A103-I203)
Accession # P41731 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As
-
AA Sequence
AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI
-
Predicted Molecular Mass
38.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)