CD63 Protein, Mouse (GST)

Customer Review

Based on 1 Customer Validation

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.

Background

The CD63 Protein functions as a cell surface receptor for TIMP1 and plays a crucial role in activating diverse cellular signaling cascades. It is involved in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Through its participation in these signaling pathways, CD63 promotes cell survival, orchestrates the reorganization of the actin cytoskeleton, facilitates cell adhesion, spreading, and migration. Additionally, it contributes to VEGFA signaling by regulating the internalization of KDR/VEGFR2. CD63 is indispensable for intracellular vesicular transport processes and is vital for the normal trafficking of the PMEL luminal domain, essential for the development and maturation of melanocytes. Furthermore, CD63 plays a role in the adhesion of leukocytes onto endothelial cells by regulating SELP trafficking. While it may be involved in mast cell degranulation in response to Ms4a2/FceRI stimulation, it does not participate in mast cell degranulation in response to other stimuli. CD63 engages in interactions with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, being essential for recruiting KDR to ITGB1 complexes, underlining its intricate involvement in various cellular processes. Additionally, CD63 interacts with SYT7.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • CD63 (A103-I203)
      Accession # P41731
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As

  • AA Sequence

    AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

  • Predicted Molecular Mass

    38.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00