CD72 Protein, Human (N-Trx-6His)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag. The total length of CD72 Protein, Human (N-Trx-6His) is 110 a.a., with molecular weight of 26-35 kDa.

CD72 emerges as a key participant in the orchestration of B-cell proliferation and differentiation. Operating as a homodimer with disulfide linkages, it forms associations with CD5, thereby contributing to intricate signaling networks within the B-cell context. Additionally, CD72 engages in interactions, particularly tyrosine phosphorylation, with the protein tyrosine phosphatase PTPN6/SHP-1, indicating its involvement in modulating cellular responses through intricate phosphorylation-based regulatory mechanisms. This highlights the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling.

Human

E. coli

N-Trx;N-His

P21854 (R117-C226)

971  [NCBI]

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC

26-35 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.