1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD8a
  5. CD8 alpha Protein, Ferret (HEK293, His)

CD8 alpha Protein, Ferret (HEK293, His)

Cat. No.: HY-P75380
COA Handling Instructions

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha Protein, Ferret (HEK293, His) is the recombinant CD8 alpha protein, expressed by HEK293 , with C-His labeled tag. The total length of CD8 alpha Protein, Ferret (HEK293, His) is 164 a.a., with molecular weight of 25-29 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $48 In-stock
10 μg $75 In-stock
50 μg $210 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha Protein, Ferret (HEK293, His) is the recombinant CD8 alpha protein, expressed by HEK293 , with C-His labeled tag. The total length of CD8 alpha Protein, Ferret (HEK293, His) is 164 a.a., with molecular weight of 25-29 kDa.

Background

The CD8 alpha protein, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions in responses against both external and internal threats. In T-cells, it functions primarily as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction facilitates the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately leading to lymphokine production, motility, adhesion, and the activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism, allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. CD8 alpha forms disulfide-linked heterodimers with CD8B at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Additionally, it interacts with the MHC class I HLA-A/B2M dimer and associates with LCK in a zinc-dependent manner.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Ferret CD8 alpha at 2 μg/mL (100 μL/well) can bind biotinylated human B2M. The ED50 for this effect is 0.4437 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Ferret CD8 alpha at 2 μg/mL (100 μL/well) can bind biotinylated human B2M,The ED50 for this effect is 0.4437 μg/mL.
Species

Others

Source

HEK293

Tag

C-His

Accession

ABS50091 (G23-E186)

Gene ID

101685563  [NCBI]

Molecular Construction
N-term
CD8 alpha (G23-E186)
Accession # ABS50091
His
C-term
Synonyms
T-cell surface glycoprotein CD8 alpha chain; CD8a; CD8A; MAL
AA Sequence

GPSQFRLSPAKVVGQLGEKVELQCEVLLPSAAPGCSWLLQKNEPAARPVFLMYLSQTRTKLADGLDSEQISGKKIRDTLYSLTLRRFRKEDEGYYFCSVLSNSVLYFSSFVPVFLPVKPTPTPAPRLPTRAPTNTSQPVSQRPGICRPPAGKPVEKGVLGFACE

Molecular Weight

25-29 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD8 alpha Protein, Ferret (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD8 alpha Protein, Ferret (HEK293, His)
Cat. No.:
HY-P75380
Quantity:
MCE Japan Authorized Agent: