1. Recombinant Proteins
  2. CD Antigens Complement System
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Complement Receptor
  4. CD93
  5. CD93/C1qR1 Protein, Human (HEK293, His)

CD93/C1qR1 Protein, Human (HEK293, His) is a recombinant human CD93 produced in HEK293 cells, with His tag. CD93 is a type 1 transmembrane glycoprotein.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CD93/C1qR1 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD93/C1qR1 Protein, Human (HEK293, His) is a recombinant human CD93 produced in HEK293 cells, with His tag. CD93 is a type 1 transmembrane glycoprotein[1].

Background

CD93 is a highly glycosylated transmembrane protein expressed on monocytes, neutrophils, endothelial cells, and stem cells. CD93 consists of a C‐type lectin‐like domain (CTLD), five epidermal growth factor‐like domains, a mucin domain, a single transmembrane domain and an intracellular domain. CD93 is upregulated in tumor vessels in many cancers, including high-grade glioma[1].

Biological Activity

Measured by its ability to induce TNF-alpha secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 8.783 μg/mL, corresponding to a specific activity is 113.8563 U/mg.

  • Measured by its ability to induce TNF-alpha secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 8.783 μg/mL, corresponding to a specific activity is 113.8563 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NPY3 (A24-K580)

Gene ID
Molecular Construction
N-term
C1qR1 (A24-K580)
Accession # Q9NPY3
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuCD93, His; Complement Component C1q Receptor; Matrix-Remodeling-Associated Protein 4CD93; CD93
AA Sequence

ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKHHHHHH

Molecular Weight

Approximately 82.5 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD93/C1qR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P7691
Quantity:
MCE Japan Authorized Agent: