CD99L2 Protein, Human (HEK293, His)
The CD99L2 protein plays a critical role in late leukocyte extravasation, helping cells to overcome the endothelial basement membrane. It acts independently at the same site as PECAM1, coordinating but uniquely participating in the complex process of leukocyte migration. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD99L2 protein plays a critical role in late leukocyte extravasation, helping cells to overcome the endothelial basement membrane. It acts independently at the same site as PECAM1, coordinating but uniquely participating in the complex process of leukocyte migration. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD99L2 assumes a crucial role in facilitating a late stage of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane. Its actions occur at the same site as PECAM1, albeit independently, suggesting a coordinated yet distinct contribution to the intricate process of leukocyte transmigration. Serving as a homophilic adhesion molecule, CD99L2 engages in interactions that, while homophilic in nature, may not be imperative for cell aggregation, underscoring the complexity of its involvement in cellular adhesive events.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8TCZ2-1 (D26-A188)
-
Molecular Construction
-
N-term
-
CD99L2 (D26-A188)
Accession # Q8TCZ2-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD99L2; MIC2-Like Protein 1; Prev. MIC2L1; CD99 Molecule-Like 2; CD99 Antigen-Like Protein 2; CD99 Antigen-Like 2; CD99B; CD99 Antigen; CD99 Molecule Like 2; MIC2 Like 1
-
AA Sequence
DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIA
-
Predicted Molecular Mass
18.4 kDa
-
Molecular Weight
Approximately 25-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
