CD99L2 Protein, Human (HEK293, His)

CD99L2 Protein plays a crucial role in late-stage leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane. Acting independently at the same site as PECAM1, it contributes coordinately yet distinctly to the intricate process of leukocyte transmigration. As a homophilic adhesion molecule, CD99L2 engages in interactions, which, while homophilic, may not be imperative for cell aggregation, highlighting the complexity of its involvement in cellular adhesive events. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CD99L2 Protein, Human (HEK293, His) is 163 a.a., with molecular weight of 25-55 kDa.

CD99L2 assumes a crucial role in facilitating a late stage of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane. Its actions occur at the same site as PECAM1, albeit independently, suggesting a coordinated yet distinct contribution to the intricate process of leukocyte transmigration. Serving as a homophilic adhesion molecule, CD99L2 engages in interactions that, while homophilic in nature, may not be imperative for cell aggregation, underscoring the complexity of its involvement in cellular adhesive events.

Human

HEK293

C-6*His

Q8TCZ2 (D26-A188)

83692  [NCBI]

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIA

25-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.