CDNF Protein, Human (163a.a, HEK293, His)

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. CDNF Protein, Human (163a.a, HEK293, His) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CDNF Protein, Human (163a.a, HEK293, His) is 163 a.a., with molecular weight of 17-20 kDa.

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a vital trophic factor with a distinctive role in supporting dopamine neurons. Its protective capabilities extend to preventing the degeneration of dopaminergic neurons induced by 6-hydroxydopamine (6-OHDA). Notably, when administered subsequent to 6-OHDA-lesioning, CDNF exhibits the remarkable ability to restore dopaminergic function and effectively thwart the degeneration of neurons within the substantia nigra, underscoring its therapeutic potential in mitigating neurodegenerative processes.

Human

HEK293

C-6*His

Q49AH0 (Q25-L187)

441549  [NCBI]

QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

17-20 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.