CDR2 Protein, Human (His)

CDR2 protein is a member of the CDR2 family. Although the description in the provided reference paragraph is limited, the CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD). CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDR2 Protein, Human (His) is 454 a.a., with molecular weight of ~55.9 kDa.

CDR2 Protein is a member of the CDR2 family. CDR2 Protein is primarily associated with paraneoplastic neurological disorders, particularly a condition known as paraneoplastic cerebellar degeneration (PCD). In patients with PCD, the immune system mistakenly targets and attacks the cerebellum, leading to the loss of cerebellar function. CDR2 Protein is thought to be an autoantigen in this process, meaning it triggers an autoimmune response.

Human

E. coli

N-6*His

Q01850 (M1-S454)

1039  [NCBI]

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Approximately 55.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.