CDR2 Protein, Human (His)
CDR2 protein is a member of the CDR2 family. CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD). CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CDR2 protein is a member of the CDR2 family. CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD). CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag.
CDR2 Protein is a member of the CDR2 family. CDR2 Protein is primarily associated with paraneoplastic neurological disorders, particularly a condition known as paraneoplastic cerebellar degeneration (PCD). In patients with PCD, the immune system mistakenly targets and attacks the cerebellum, leading to the loss of cerebellar function. CDR2 Protein is thought to be an autoantigen in this process, meaning it triggers an autoimmune response.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q01850 (M1-S454)
-
Molecular Construction
-
N-term
-
6*His
-
CDR2 (M1-S454)
Accession # Q01850 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CDR2; Cerebellar Degeneration-Related Protein 2; Cerebellar Degeneration Related Protein 2; Major Yo Paraneoplastic Antigen; CDR62; Yo Paraneoplastic Antigen; Yo; Cerebellar Degeneration-Related Protein (62kD); Paraneoplastic Cerebellar Degeneration-Assoc
-
AA Sequence
MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
-
Predicted Molecular Mass
55.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
