CELA3A Protein, Human (HEK293, His)
Based on 1 Customer Validation
CELA3A Protein, an efficient alanine-specific protease, exhibits minimal elastolytic activity. CELA3A Protein, Human (HEK293, His) is the recombinant human-derived CELA3A protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CELA3A Protein, an efficient alanine-specific protease, exhibits minimal elastolytic activity. CELA3A Protein, Human (HEK293, His) is the recombinant human-derived CELA3A protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CELA3A Protein functions as an efficient protease with a specificity for alanine, demonstrating limited elastolytic activity.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P09093 (S16-H270)
-
Molecular Construction
-
N-term
-
CELA3A (S16-H270)
Accession # P09093 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CELA3A; Elastase IIIA; Prev. ELA3A; Chymotrypsin-Like Elastase Family, Member 3A; ELA3; Chymotrypsin Like Elastase Family Member 3A; Protease E; Elastase 3A, Pancreatic (Protease E); Chymotrypsin-Like Elastase Family Member 3A; Elastase 1; Elastase 3A, Pancreatic; Chymotrypsin Like Elastase 3A; Elastase-3A
-
AA Sequence
SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
-
Predicted Molecular Mass
28.9 kDa
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
