1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CELA3A Protein, Human (HEK293, His)

CELA3A Protein, Human (HEK293, His)

Cat. No.: HY-P70133
COA Handling Instructions

CELA3A Protein, an efficient alanine-specific protease, exhibits minimal elastolytic activity. CELA3A Protein, Human (HEK293, His) is the recombinant human-derived CELA3A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CELA3A Protein, Human (HEK293, His) is 255 a.a., with molecular weight of ~31.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CELA3A Protein, an efficient alanine-specific protease, exhibits minimal elastolytic activity. CELA3A Protein, Human (HEK293, His) is the recombinant human-derived CELA3A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CELA3A Protein, Human (HEK293, His) is 255 a.a., with molecular weight of ~31.0 kDa.

Background

CELA3A Protein functions as an efficient protease with a specificity for alanine, demonstrating limited elastolytic activity.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P09093 (S16-H270)

Gene ID
Molecular Construction
N-term
CELA3A (S16-H270)
Accession # P09093
6*His
C-term
Synonyms
rHuChymotrypsin-like elastase family member 3A/CELA3A, His; Chymotrypsin-Like Elastase Family Member 3A; Elastase IIIA; Elastase-3A; Protease E; CELA3A; ELA3; ELA3A
AA Sequence

SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH

Molecular Weight

Approximately 31.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CELA3A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CELA3A Protein, Human (HEK293, His)
Cat. No.:
HY-P70133
Quantity:
MCE Japan Authorized Agent: