Centrin-2 Protein, Human (His)
Based on 1 Customer Validation
Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (His) is the recombinant human-derived Centrin-2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (His) is the recombinant human-derived Centrin-2 protein, expressed by E. coli , with N-6*His labeled tag.
Centrin-2 Protein assumes a fundamental role in the structure and function of the microtubule organizing center, particularly in centriole duplication and the proper formation of spindles during cell division. Beyond its central role in these processes, Centrin-2 contributes to the regulation of cytokinesis and maintenance of genome stability through collaborative interactions with CALM1 and CCP110. Additionally, it is intricately involved in global genome nucleotide excision repair (GG-NER) by acting as a crucial component of the XPC complex. In partnership with RAD23B, Centrin-2 appears to stabilize XPC, and in vitro, it stimulates the DNA binding of the XPC:RAD23B dimer, highlighting its multifaceted involvement in cellular mechanisms essential for genomic integrity and cell division.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P41208 (A2-Y172)
-
Molecular Construction
-
N-term
-
6*His
-
Centrin-2 (A2-Y172)
Accession # P41208 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CETN2; Centrin, EF-Hand Protein, 2; Prev. CALT; Caltractin (20kD Calcium-Binding Protein); CEN2; Caltractin Isoform 1; Centrin 2; Centrin-2
-
AA Sequence
ASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
