CHRNB3 Protein, Human (HEK293, His)
CHRNB3 Protein, a vital constituent of the acetylcholine receptor (AChR), induces a significant conformational shift upon acetylcholine binding. This change affects all subunits, leading to the activation of an ion-conducting channel across the plasma membrane. The neuronal AChR complex comprises alpha and beta subunits, emphasizing their intricate collaboration in responding to acetylcholine stimulation. CHRNB3 Protein, Human (HEK293, His) is the recombinant human-derived CHRNB3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CHRNB3 Protein, a vital constituent of the acetylcholine receptor (AChR), induces a significant conformational shift upon acetylcholine binding. This change affects all subunits, leading to the activation of an ion-conducting channel across the plasma membrane. The neuronal AChR complex comprises alpha and beta subunits, emphasizing their intricate collaboration in responding to acetylcholine stimulation. CHRNB3 Protein, Human (HEK293, His) is the recombinant human-derived CHRNB3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
After binding acetylcholine, CHRNB3, an essential component of the acetylcholine receptor (AChR), triggers a profound conformational change that influences all subunits, ultimately resulting in the opening of an ion-conducting channel across the plasma membrane. The neuronal AChR complex is thought to consist of two distinct types of subunits, namely alpha and beta, highlighting the intricate interplay between these subunits in mediating the cellular response to acetylcholine stimulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q05901 (I25-L232)
-
Molecular Construction
-
N-term
-
CHRNB3 (I25-L232)
Accession # Q05901 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CHRNB3; Cholinergic Receptor, Nicotinic, Beta 3 (Neuronal); Cholinergic Receptor Nicotinic Beta 3 Subunit; Neuronal Acetylcholine Receptor Subunit Beta-3; Acetylcholine Receptor, Nicotinic, Beta 3 (Neuronal); Cholinergic Receptor, Nicotinic Beta 3; Cholin
-
AA Sequence
IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRL
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
