CIRBP Protein, Human (His)

CIRBP is a cold-induced mRNA-binding protein that plays a key role in cellular responses to genotoxic stress, exerting a protective effect by stabilizing transcripts of genes critical for cell survival. As a translation activator, CIRBP appears to be critical for cold-induced inhibition of cell proliferation. CIRBP Protein, Human (His) is the recombinant human-derived CIRBP protein, expressed by E. coli , with N-His labeled tag.

Cold-Inducible RNA Binding Protein (CIRBP) is a crucial player in the cellular response to genotoxic stress, exerting a protective role by stabilizing transcripts of genes associated with cell survival. As a translational activator, CIRBP is involved in the cold-induced suppression of cell proliferation and binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. It acts as a translational repressor, promoting the assembly of stress granules (SGs) when overexpressed. Additionally, CIRBP interacts with EIF4G1 and associates with ribosomes, emphasizing its multifaceted involvement in cellular stress responses and RNA processing (

Human

E. coli

N-His

Q14011-1 (M1-E172)

1153  [NCBI]

Full Length of Isoform-1

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Approximately 23 kDa.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 0.25M Imi, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

/

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/hel-cell.html  [Content Brief]