Citrate Synthase/CS Protein, Human (sf9, His)
Based on 1 Customer Validation
Citrate synthase (CS) is a key enzyme in carbohydrate metabolism, especially in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA into citric acid. This enzymatic process represents the first and critical step in the TCA cycle, which is the basis of cellular energy production. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Citrate synthase (CS) is a key enzyme in carbohydrate metabolism, especially in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA into citric acid. This enzymatic process represents the first and critical step in the TCA cycle, which is the basis of cellular energy production. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Citrate synthase (CS) is a vital enzyme in carbohydrate metabolism, specifically within the tricarboxylic acid (TCA) cycle. It catalyzes the condensation of acetyl-CoA and oxaloacetate to form citrate, marking the initial step in the TCA cycle. This process occurs in the mitochondria and serves as a key junction in cellular energy metabolism, linking glycolysis and fatty acid oxidation to the TCA cycle. Citrate synthase plays a crucial role in the generation of citrate, a pivotal intermediate that undergoes subsequent enzymatic reactions leading to the production of reducing equivalents, such as NADH and FADH2. It has to highlight the specific biochemical transformation catalyzed by citrate synthase, converting oxaloacetate to isocitrate during the TCA cycle, underscoring its central role in cellular energy production.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
O75390 (A28-G466)
-
Molecular Construction
-
N-term
-
CS (A28-G466)
Accession # O75390 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CS; Citrate Synthase, Mitochondrial; Citrate Synthase; Citrate (Si)-Synthase
-
AA Sequence
ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG
-
Predicted Molecular Mass
50.4 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
