CL-L1/COLEC10 Protein, Mouse (HEK293, Fc)

CL-L1/COLEC10, operating as a lectin, displays distinct sugar-binding preferences, with a hierarchy of galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Apart from its sugar-binding role, CL-L1/COLEC10 functions as a chemoattractant, suggesting potential engagement in the modulation of cell migration. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CL-L1/COLEC10 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is 159 a.a., with molecular weight of 53-57 kDa.

CL-L1 (COLEC10) is a lectin protein with a high binding affinity for various sugars, displaying specificity in the following order: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. As a lectin, CL-L1 likely plays a role in sugar recognition and binding, and its diverse sugar specificity suggests potential involvement in various cellular processes. Notably, CL-L1 acts as a chemoattractant, implying a probable role in the regulation of cell migration. The ability of CL-L1 to attract cells suggests its participation in the modulation of cellular movements, possibly influencing processes such as immune cell trafficking or tissue repair. The sugar-binding specificity and chemoattractant properties of CL-L1 highlight its potential significance in mediating interactions between cells and their microenvironment, emphasizing its role in cellular responses and migration regulation (adapted from the provided passage).

Immobilized Recombinant Human Integrin alpha X beta 2 Protein Protein at 5 µg/mL (100 µL/well) can bind Biotinylated Mouse CL-L1 protein. The ED₅₀ for this effect is 2.839 μg/mL, corresponding to a specific activity is 352.237 Unit/mg.

Mouse

HEK293

N-hFc

Q8CF98 (C119-K277)

239447  [NCBI]

CDCGRYRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK

Approximately 53-57 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.