CL-L1/COLEC10 Protein, Mouse (HEK293, Fc)

CL-L1/COLEC10, operating as a lectin, displays distinct sugar-binding preferences, with a hierarchy of galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Apart from its sugar-binding role, CL-L1/COLEC10 functions as a chemoattractant, suggesting potential engagement in the modulation of cell migration. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CL-L1/COLEC10 protein, expressed by HEK293 , with N-hFc labeled tag.

CL-L1 (COLEC10) is a lectin protein with a high binding affinity for various sugars, displaying specificity in the following order: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. As a lectin, CL-L1 likely plays a role in sugar recognition and binding, and its diverse sugar specificity suggests potential involvement in various cellular processes. Notably, CL-L1 acts as a chemoattractant, implying a probable role in the regulation of cell migration. The ability of CL-L1 to attract cells suggests its participation in the modulation of cellular movements, possibly influencing processes such as immune cell trafficking or tissue repair. The sugar-binding specificity and chemoattractant properties of CL-L1 highlight its potential significance in mediating interactions between cells and their microenvironment, emphasizing its role in cellular responses and migration regulation.

Immobilized Recombinant Human Integrin alpha X beta 2 Protein Protein at 5 µg/mL (100 µL/well) can bind Biotinylated Mouse CL-L1 protein. The ED₅₀ for this effect is 2.839 μg/mL, corresponding to a specific activity is 352.237 Unit/mg.

• 
  Immobilized Recombinant Human Integrin alpha X beta 2 Protein Protein at 5 µg/mL (100 µL/well) can bind Biotinylated Mouse CL-L1 protein. The ED₅₀ for this effect is 2.839 μg/mL, corresponding to a specific activity is 352.237 Unit/mg.

Mouse

HEK293

N-hFc

Q8CF98 (C119-K277)

239447  [NCBI]

Partial

CDCGRYRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK

Approximately 53-57 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.