1. Recombinant Proteins
  2. Others
  3. Claudin-11/CLDN11 Protein, Human (HEK293, Fc)

Claudin-11/CLDN11 Protein, Human (HEK293, Fc)

Cat. No.: HY-P74250
Handling Instructions Technical Support

Claudin-11/CLDN11 Protein plays a crucial role in tightly closing intercellular spaces in tight junctions, facilitated by its calcium-independent cell-adhesion capabilities. Interacting with tetraspanin-3/TSPAN3 suggests potential collaboration in cellular processes. CLDN11's associations with OCLN highlight its involvement in molecular interactions, contributing to the structural integrity and functional regulation of tight junctions. Claudin-11/CLDN11 Protein, Human (HEK293, Fc) is the recombinant human-derived Claudin-11/CLDN11 protein, expressed by HEK293 , with N-mFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Claudin-11/CLDN11 Protein plays a crucial role in tightly closing intercellular spaces in tight junctions, facilitated by its calcium-independent cell-adhesion capabilities. Interacting with tetraspanin-3/TSPAN3 suggests potential collaboration in cellular processes. CLDN11's associations with OCLN highlight its involvement in molecular interactions, contributing to the structural integrity and functional regulation of tight junctions. Claudin-11/CLDN11 Protein, Human (HEK293, Fc) is the recombinant human-derived Claudin-11/CLDN11 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

Claudin-11 (CLDN11) assumes a crucial role in the precise closure of the intercellular space within tight junctions, primarily facilitated by its calcium-independent cell-adhesion capabilities. This protein also engages in interactions with tetraspanin-3/TSPAN3, indicating potential collaborative roles within cellular processes. Furthermore, CLDN11 forms associations with OCLN, as observed in experimental findings, elucidating its involvement in molecular interactions that contribute to the structural integrity and functional regulation of tight junctions.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

O75508 (V23-R82)

Gene ID
Molecular Construction
N-term
mFc
CLDN11 (V23-R82)
Accession # O75508
C-term
Protein Length

Extracellular Domain

Synonyms
Claudin-11; CLDN11; OSP; OTM
AA Sequence

VTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACR

Predicted Molecular Mass
33.2 kDa
분자량

Approximately 37 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Claudin-11/CLDN11 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Claudin-11/CLDN11 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Claudin-11/CLDN11 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74250
수량:
MCE Japan Authorized Agent: