Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293)

Claudin-6/CLDN6 Protein-VLP, Human (Biotinylated, HEK293) is recommended only for SPR analysis. HY-P77899 can be used in animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.

Biotinylated Human Claudin 6 VLP captured on CM5 Chip via Streptavidin can bind Anti-Claudin6 Antibody with an affinity constant of <0.43 nM as determined in SPR assay (Biacore T200).

Human

HEK293

Tag Free

P56747 (M1-V220)

9074  [NCBI]

Full Length

Biotin

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

≥ 95%, as determined by HPLC.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 300 mM L-arginine, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.