Claudin-6/CLDN6 Protein-VLP, Human (HEK293, His)

Claudin-6/CLDN6 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody , the EC₅₀ is 1.501-2.553 ng/mL.

Human

HEK293

C-10*His

P56747 (M1-V220)

9074  [NCBI]

Full Length

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

25.1 kDa

Purity analysis by SDS-PAGE is not available for VLP proteins.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hepg2-cell.html