CLIC1 Protein, Human (N-His)

The CLIC1 protein exhibits specific lysophospholipase activity and plays a critical role in mediating cellular responses to oxidative stress. As a member of the chloride intracellular channel family, CLIC1 is involved in a variety of physiological processes, including cell volume regulation, membrane potential regulation, and regulation of cell cycle progression. CLIC1 Protein, Human (N-His) is the recombinant human-derived CLIC1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CLIC1 Protein, Human (N-His) is 240 a.a., with molecular weight of ~29 kDa.

CLIC1 protein can insert into membranes and form chloride ion channels, while CLIC1 channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. CLIC1 is involved in regulation of the cell cycle. CLIC1 seems to have very low affinity for glutathione, even though glutathione binding was observed in protein crystals.

Data is not available.

Human

E. coli

N-6*His

O00299 (A2-K241)

1192  [NCBI]

AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Approximately 29 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.