CLIC1 Protein, Human (N-His)

Customer Review

Based on 1 Customer Validation

The CLIC1 protein exhibits specific lysophospholipase activity and plays a critical role in mediating cellular responses to oxidative stress. As a member of the chloride intracellular channel family, CLIC1 is involved in a variety of physiological processes, including cell volume regulation, membrane potential regulation, and regulation of cell cycle progression. CLIC1 Protein, Human (N-His) is the recombinant human-derived CLIC1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CLIC1 protein exhibits specific lysophospholipase activity and plays a critical role in mediating cellular responses to oxidative stress. As a member of the chloride intracellular channel family, CLIC1 is involved in a variety of physiological processes, including cell volume regulation, membrane potential regulation, and regulation of cell cycle progression. CLIC1 Protein, Human (N-His) is the recombinant human-derived CLIC1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CLIC1 protein can insert into membranes and form chloride ion channels, while CLIC1 channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. CLIC1 is involved in regulation of the cell cycle. CLIC1 seems to have very low affinity for glutathione, even though glutathione binding was observed in protein crystals.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CLIC1 (A2-K241)
      Accession # O00299
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CLIC1; Glutaredoxin-Like Oxidoreductase CLIC1; Chloride Intracellular Channel 1; Nuclear Chloride Ion Channel 27; NCC27; Chloride Channel ABP; G6; HRNCC; P64CLCP; Chloride Intracellular Channel Protein; CLCNL1; Nuclear Chloride Ion Channel Protein; Glutat

  • AA Sequence

    AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

  • Predicted Molecular Mass

    27 kDa

  • Molecular Weight

    Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00