Clumping factor A Protein, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Clumping factor A (ClfA) protein is a cell surface-associated protein that plays a significant role in bacterial virulence. This protein is implicated in the pathogenicity of bacteria by promoting bacterial attachment exclusively to the gamma-chain of human fibrinogen. By selectively binding to the gamma-chain, ClfA facilitates the adherence of bacteria to host tissues, a crucial step in the establishment of infections. Additionally, ClfA induces the formation of bacterial clumps, which may enhance bacterial survival and evasion of the host immune response. Serval researches indicatethat ClfA is a cell surface-associated protein implicated in virulence, specifically highlighting its role in promoting bacterial attachment to the gamma-chain of human fibrinogen and inducing the formation of bacterial clumps.

Staphylococcus aureus

E. coli

Tag Free

Q6GB45 (G228-E558)

/

Partial

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.