Clumping factor A Protein, S. aureus (P.pastoris, His)
Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Staphylococcus aureus
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.
Technical Parameters
-
Species Staphylococcus aureus
-
Source P. pastoris
-
Tag N-His
-
Accession
Q5HHM8 (G229-E559)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
Clumping factor A (G229-E559)
Accession # Q5HHM8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SAS0752; clfA; Fibrinogen-binding protein A; Fibrinogen receptor A; Clumping factor A
-
AA Sequence
GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
-
Predicted Molecular Mass
38.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
