1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Clumping factor A Protein, S. aureus (P.pastoris, His)

Clumping factor A Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71829
Handling Instructions Technical Support

Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Clumping factor A protein facilitates bacterial attachment to human fibrinogen gamma-chain, promoting the formation of bacterial clumps. It is a cell surface-associated protein and plays a role in bacterial virulence. Clumping factor A Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by P. pastoris , with N-His labeled tag.

Background

Clumping factor A Protein is a cell surface-associated protein known for its role in bacterial virulence. It specifically facilitates bacterial attachment to the gamma-chain of human fibrinogen, promoting the formation of bacterial clumps (By similarity).

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-His

Accession

Q5HHM8 (G229-E559)

Gene ID

/

Molecular Construction
N-term
His
Clumping factor A (G229-E559)
Accession # Q5HHM8
C-term
Protein Length

Partial

Synonyms
clfA; Fibrinogen receptor A; Fibrinogen-binding protein A
AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Predicted Molecular Mass
38.5 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Clumping factor A Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Clumping factor A Protein, S. aureus (P.pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Clumping factor A Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71829
수량:
MCE Japan Authorized Agent: