1. Recombinant Proteins
  2. Receptor Proteins
  3. CMG-2/ANTXR2 Protein, Human (HEK293, Fc)

CMG-2/ANTXR2 is essential for cellular interactions with laminin and the extracellular matrix. As a receptor for the protective antigen (PA) of B. anthracis, it undergoes heptamerization upon PA binding. The complex is internalized through a clathrin-dependent pathway, and in the endosomal membrane (pH < 7), it rearranges to form a pore, facilitating the entry of other components of anthrax toxin into the cytoplasm. CMG-2/ANTXR2 Protein, Human (HEK293, Fc) is the recombinant human-derived CMG-2/ANTXR2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CMG-2/ANTXR2 is essential for cellular interactions with laminin and the extracellular matrix. As a receptor for the protective antigen (PA) of B. anthracis, it undergoes heptamerization upon PA binding. The complex is internalized through a clathrin-dependent pathway, and in the endosomal membrane (pH < 7), it rearranges to form a pore, facilitating the entry of other components of anthrax toxin into the cytoplasm. CMG-2/ANTXR2 Protein, Human (HEK293, Fc) is the recombinant human-derived CMG-2/ANTXR2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CMG-2/ANTXR2 protein is essential for cellular interactions with laminin and the extracellular matrix. In the context of microbial infection, it serves as a receptor for the protective antigen (PA) of Bacillus anthracis. PA binding triggers the heptamerization of the receptor-PA complex, and this complex translocates to glycosphingolipid-rich lipid rafts, where it undergoes internalization through a clathrin-dependent pathway. Within the endosomal membrane and under acidic conditions (pH under 7), the complex undergoes rearrangement, forming a pore that facilitates the escape of other components of anthrax toxin into the cytoplasm. This process highlights the crucial role of CMG-2/ANTXR2 in the cellular response to B. anthracis infection and the subsequent internalization and translocation of anthrax toxin components.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P58335-4 (Q34-N317)

Gene ID
Molecular Construction
N-term
CMG-2 (Q34-N317)
Accession # P58335-4
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Anthrax toxin receptor 2; Capillary morphogenesis gene 2 protein; CMG-2; ANTXR2
AA Sequence

QEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSN

Predicted Molecular Mass
57.4 kDa
Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CMG-2/ANTXR2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CMG-2/ANTXR2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CMG-2/ANTXR2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76151
Quantity:
MCE Japan Authorized Agent: