1. Recombinant Proteins
  2. Others
  3. Collagen alpha-1(XVIII) chain/COL18A1 Protein, Mouse (HEK293, His)

Collagen alpha-1(XVIII) chain/COL18A1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70347
SDS COA Handling Instructions

The COL18A1 protein may play a key role in shaping retinal structure and promoting neural tube closure. Its involvement extends to the regulation of extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells. Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(XVIII) chain/COL18A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COL18A1 protein may play a key role in shaping retinal structure and promoting neural tube closure. Its involvement extends to the regulation of extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells. Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(XVIII) chain/COL18A1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 a.a., with molecular weight of ~18.0 kDa.

Background

The COL18A1 protein likely plays a pivotal role in shaping the retinal structure and contributing to the closure of the neural tube. Its involvement extends to the potential regulation of extracellular matrix-dependent motility and morphogenesis in both endothelial and non-endothelial cells. For these functions, homotrimerization of COL18A1 is essential, and the processes are implicated in MAPK signaling pathways. The multifaceted roles of COL18A1 suggest its significance in orchestrating cellular dynamics and tissue development, particularly in the intricate processes of retinal formation and neural tube closure.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P39061 (H1591-K1774)

Gene ID
Molecular Construction
N-term
COL18A1 (H1591-K1774)
Accession # P39061
6*His
C-term
Synonyms
rMuCollagen Alpha-1(XVIII) Chain/Endostatin, His; antiangiogenic agent; COL18A1; collagen alpha-1(XVIII)chain; collagen; type XVIII; Endostatin
AA Sequence

HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Collagen alpha-1(XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collagen alpha-1(XVIII) chain/COL18A1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70347
Quantity:
MCE Japan Authorized Agent: