COMMD9 Protein, Human (His)
Based on 1 Customer Validation
COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.
The COMMD9 protein is implicated in modulating the activity of cullin-RING E3 ubiquitin ligase (CRL) complexes, suggesting its role in the regulation of ubiquitin-dependent protein degradation pathways. Additionally, it may down-regulate the activation of NF-kappa-B, indicating its involvement in modulating immune and inflammatory responses. In epithelial cells, COMMD9 plays a role in the modulation of Na(+) transport by regulating the apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits. The protein interacts with RELB and NFKB1/p105, underscoring its potential involvement in NF-kappa-B signaling pathways. Furthermore, COMMD9 engages with CCDC22, CCDC93, SCNN1B, and CUL1, pointing towards its diverse interactions with various proteins involved in cellular processes such as protein degradation, ion transport, and immune response. These findings highlight the versatile and regulatory functions of COMMD9 within cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9P000-1 (M1-K198)
-
Gene ID29099 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
COMMD9 (M1-K198)
Accession # Q9P000-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
COMMD9; CDNA, FLJ95283, Highly Similar To Homo Sapiens COMM Domain Containing 9 (COMMD9), MRNA; COMM Domain Containing 9; CDNA FLJ78335, Highly Similar To Homo Sapiens COMM Domain Containing 9, MRNA; HSPC166; COMM Domain Containing 9, Isoform CRA_b; COMM
-
AA Sequence
MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
