CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc)

CRTAM/CD355 protein regulates T-cell subsets by mediating cell-cell adhesion. It interacts with CADM1 to enhance NK cell cytotoxicity, IFNG secretion by CD8+ T-cells, and NK cell-mediated tumor rejection. CRTAM regulates CD8+ T-cell proliferation but not cytotoxicity. It also promotes CD4+ T-cell polarization and regulates TCR-mediated proliferation and cytokine production. CRTAM contributes to the retention of activated CD8+ T-cells in lymph nodes and intestinal retention of intraepithelial T-cells. It may exist as a monomer or homodimer and interacts with SCRIB to promote polarization in CD4+ T-cells. CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-hFc labeled tag.

CRTAM functions as a key mediator of heterophilic cell-cell adhesion, playing a crucial role in regulating the activation, differentiation, and tissue retention of various T-cell subsets. Its interaction with CADM1 promotes natural killer (NK) cell cytotoxicity, IFNG/interferon-gamma secretion by CD8+ T-cells, and NK cell-mediated rejection of tumors expressing CADM1. CRTAM is involved in the regulation of CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation, but it appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Additionally, its interaction with SCRIB promotes the late phase of cellular polarization in a subset of CD4+ T-cells, regulating TCR-mediated proliferation, as well as the production of IFNG, IL17, and IL22. CRTAM, by interacting with CADM1 on CD8+ dendritic cells, contributes to the retention of activated CD8+ T-cells within the draining lymph node. Furthermore, it is required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells. Its interaction with CADM1 also promotes adhesion to gut-associated CD103+ dendritic cells, facilitating the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells. CRTAM may exist as a monomer or homodimer, with its homodimerization being influenced by interactions with CADM1. Additionally, it interacts with SCRIB, promoting polarization in a subset of CD4+ T-cells^[1][2][3][4].

Cynomolgus

HEK293

C-hFc

XP_005580021.1 (S18-G287)

102125896  [NCBI]

Partial

SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG

Approximately 70-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.