1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. CRTAM/CD355
  5. CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc)

CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc)

Art. -Nr.: HY-P77636
Handling Instructions Technical Support

CRTAM/CD355 protein regulates T-cell subsets by mediating cell-cell adhesion. It interacts with CADM1 to enhance NK cell cytotoxicity, IFNG secretion by CD8+ T-cells, and NK cell-mediated tumor rejection. CRTAM regulates CD8+ T-cell proliferation but not cytotoxicity. It also promotes CD4+ T-cell polarization and regulates TCR-mediated proliferation and cytokine production. CRTAM contributes to the retention of activated CD8+ T-cells in lymph nodes and intestinal retention of intraepithelial T-cells. It may exist as a monomer or homodimer and interacts with SCRIB to promote polarization in CD4+ T-cells. CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-hFc labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

CRTAM/CD355 protein regulates T-cell subsets by mediating cell-cell adhesion. It interacts with CADM1 to enhance NK cell cytotoxicity, IFNG secretion by CD8+ T-cells, and NK cell-mediated tumor rejection. CRTAM regulates CD8+ T-cell proliferation but not cytotoxicity. It also promotes CD4+ T-cell polarization and regulates TCR-mediated proliferation and cytokine production. CRTAM contributes to the retention of activated CD8+ T-cells in lymph nodes and intestinal retention of intraepithelial T-cells. It may exist as a monomer or homodimer and interacts with SCRIB to promote polarization in CD4+ T-cells. CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CRTAM functions as a key mediator of heterophilic cell-cell adhesion, playing a crucial role in regulating the activation, differentiation, and tissue retention of various T-cell subsets. Its interaction with CADM1 promotes natural killer (NK) cell cytotoxicity, IFNG/interferon-gamma secretion by CD8+ T-cells, and NK cell-mediated rejection of tumors expressing CADM1. CRTAM is involved in the regulation of CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation, but it appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Additionally, its interaction with SCRIB promotes the late phase of cellular polarization in a subset of CD4+ T-cells, regulating TCR-mediated proliferation, as well as the production of IFNG, IL17, and IL22. CRTAM, by interacting with CADM1 on CD8+ dendritic cells, contributes to the retention of activated CD8+ T-cells within the draining lymph node. Furthermore, it is required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells. Its interaction with CADM1 also promotes adhesion to gut-associated CD103+ dendritic cells, facilitating the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells. CRTAM may exist as a monomer or homodimer, with its homodimerization being influenced by interactions with CADM1. Additionally, it interacts with SCRIB, promoting polarization in a subset of CD4+ T-cells[1][2][3][4].

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_005580021.1 (S18-G287)

Gene ID
Molecular Construction
N-term
CRTAM (S18-G287)
Accession # XP_005580021.1
hFc
C-term
Protein Length

Partial

Synonyms
CD355 antigen; CD355; CRTAM
AA Sequence

SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG

Predicted Molecular Mass
56.6 kDa
Molekulargewicht

Approximately 70-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Reinheit

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation

CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
CRTAM/CD355 Protein, Cynomolgus (HEK293, Fc)
Art. -Nr.:
HY-P77636
Menge:
MCE Japan Authorized Agent: