CRTAM/CD355 Protein, Cynomolgus (HEK293, His)
CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivosup>[3]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivo[1][2]sup>[3][4]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Class I-restricted T cell-associated molecule (CRTAM) is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also known as CD355 or cytotoxic and regulatory T-cell molecule (expressed by activated CD8+ and NK T cells). In addition, CRTAM is expressed in several non-immune tissues, including liver, lung, testis, kidney, intestine, and brain. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. Noticeably, activated T cells and NK cells only transiently express CRTAM[1][3].
CRTAM takes part in kinds of signaling pathways, including cellular adhesion, polarity, and proliferation. CRTAM regulates lymphocyte function, and also promotes TCD8+ cell adhesion and retention within the lymph node. Besides, it induces a late phase of cell polarity during activation and regulates effector function in a small subset of TCD4 cells[1][2]. Furthermore, CRTAM can interact with Necl-2 (a ligand for CRTAM), and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, as well as NK cell-mediated rejection of tumors expressing Necl-2 in vivo. CRTAM shows some sequence homology to nectins and Necls[3][4].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_005580021.1 (S18-G287)
-
Molecular Construction
-
N-term
-
CRTAM (S18-G287)
Accession # XP_005580021.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CRTAM; Cytotoxic And Regulatory T-Cell Molecule; Cytotoxic And Regulatory T Cell Molecule; Class I MHC Restricted T Cell Associated Molecule; CD355; CD355 Antigen; Class-I MHC-Restricted T-Cell-Associated Molecule
-
AA Sequence
SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG
-
Predicted Molecular Mass
30.8 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
